Synopsis
Lucifer,anordinaryorphanboywhowasbroughtupbyawealthyfamilytobetheplaymateoftheirdaughter.That'showthingshavebeenuntilonenight,whenhegotattackbysomethingunnatural,thatwasthenighttheworldchangedforhim.p.sThisworldisgoingtobedark,lotsofkillings,alotofr18contents,mostnoteveninvolvingtheMC,alsoMcisnotgoingtotakeallthegirlshecomesacross,hewillhavefemalefriendshewillmakealongtheway,therewillbeYuricontentsandlotsmore,butActionsprevailsthemall.
Readers Also Like
Same author
I Am Zeus
AmanfrommodernEarthisreincarnatedintobabyZeus.ArmwithfutureknowledgeoftheGreekmythologyevenifitwaslittle,itstillcoveredmajoreve...
Same author
My Infinite System.
LucianBlackawakenedtobethemostpowerfulhunterintheworld,butheevenwithallthesepowers,hecouldnotprotectthatwhichheholdsdear,andhad...
Similar genre
Absolute God: An Immortal Soul Among Nobles
Animmortalwhoreachedthepinnacleofpowerinhisworld,wearyofexistence,decidestoentertheriverofreincarnationtoexperienceanewbeginnin...
Similar genre
Working in a Zoo with Beast Taming System
YangQiobtainedabeast-tamingcultivationsystem,andhisinitialmissionrequiredhimtojointheBeastTamingSect.Butwhereinrealityistherea“...
Similar genre
That's How We Necromancers Do Things
Lynch,anelementaryNecromancerswhowantedtogrindhisskeleton-summoningskills,foundagreatplace--theHolyMaidenConvent.However,hehear...
Similar genre
Harry Potter: Se'x Oriented Hogwarts
“Please,Daddyfuckme.Ineedyousomuch!”Luciferletgoofherbumandslidhishandunderherhip,goingstraightforherpussy.Herpetalsweresilkenw...
Chapters 291
- Chapter 291: The Collector’s Trail May 23, 2026
- Chapter 290: The Coast of Broken Things May 23, 2026
- Chapter 289: The Library of Lost Names May 23, 2026
- Chapter 288: The Threshold May 23, 2026
- Chapter 287: The Awakening and the Departure May 23, 2026
- Chapter 286: One Hundred Years Later May 23, 2026
- Chapter 285: The Long Road Home May 20, 2026
- Chapter 284: What Comes After May 20, 2026
- Chapter 283: Endgame 2: The Progenitor’s Wager May 20, 2026
- Chapter 282: Endgame 1 May 20, 2026
- Chapter 281: Climax 2 May 20, 2026
- Chapter 280: Climax 1 May 20, 2026
- Chapter 279 279: Welcome Progenitor May 20, 2026
- Chapter 278 278: Done Watching May 20, 2026
- Chapter 277 277: Evolution May 20, 2026
- Chapter 276 276: the True Progenitor of the Vampire Line May 20, 2026
- Chapter 275 275: The Revenant May 20, 2026
- Chapter 274 274: “That’s… not part of the script.” May 20, 2026
- Chapter 273 273: King Of The Crimson Night May 20, 2026
- Chapter 272 272: “Just… just don’t get yourselves killed.” May 20, 2026
- Chapter 271 271: Surprised Ally May 20, 2026
- Chapter 270 270: Just Business May 20, 2026
- Chapter 269 269: A Killing Spree May 20, 2026
- Chapter 268 268: “I’m what comes next.” May 20, 2026
- Chapter 267 267: "Perfect. Let hate carve the path." May 20, 2026
- Chapter 266 266: Lucifer vs. Nythra May 20, 2026
- Chapter 265 265: Nythra May 20, 2026
- Chapter 264 264: Back To Earth May 20, 2026
- Chapter 263 263: “We’ll bring her back. No matter what it ta May 20, 2026
- Chapter 262 262: The Last Words May 20, 2026
- Chapter 261 261: The Remains May 20, 2026
- Chapter 260 260: Ken And Dera May 20, 2026
- Chapter 259 259: Fatherly Talk May 20, 2026
- Chapter 258 258: “Fuck, you’re trouble,”* May 20, 2026
- Chapter 257 257: “Don’t do that.”* May 20, 2026
- Chapter 256 256: Preparations May 20, 2026
- Chapter 255: Your Maker May 20, 2026
- Chapter 254: New Dera May 20, 2026
- Chapter 253: The Gathering May 20, 2026
- Chapter 252 252: The Gathering Of The Firsts May 20, 2026
- Chapter 251: Cosmic Unrest May 20, 2026
- Chapter 250: The Adversaries May 20, 2026
- Chapter 249: “Fuck, Luna,”* May 20, 2026
- Chapter 248: “Ride me,”* May 20, 2026
- Chapter 247: “Your turn,”* May 20, 2026
- Chapter 246: Return To The V World May 20, 2026
- Chapter 245: "The Demon King of Gluttony." May 20, 2026
- Chapter 244: Remu Is Back May 20, 2026
- Chapter 243: “Lord Daniel awaits,”* May 20, 2026
- Chapter 242: “God no,” May 20, 2026
- Chapter 241: Family Reunion May 20, 2026
- Chapter 240: Waking Lilith May 20, 2026
- Chapter 239: Going To See Lilith May 20, 2026
- Chapter 238: King Of Gluttony May 20, 2026
- Chapter 237: The Kings May 20, 2026
- Chapter 236: Incubus Form May 20, 2026
- Chapter 235: Meeting Daniel May 20, 2026
- Chapter 234: Going To The Demon Realm May 20, 2026
- Chapter 233: Remu May 20, 2026
- Chapter 232: New Earth May 20, 2026
- Chapter 231: Brother’s Talk May 20, 2026
- Chapter 230: Rewards May 20, 2026
- Chapter 229: [Primordial Blood Drive] May 20, 2026
- Chapter 228: [Welcome to the 100th Floor.] May 20, 2026
- Chapter 227: "Now I know you’re dying." May 20, 2026
- Chapter 226: “Cum for me, Zane.”* May 20, 2026
- Chapter 225: "That’s the question, isn’t it?" May 20, 2026
- Chapter 224: (No one knows.) May 20, 2026
- Chapter 223: "That was… intense."* May 20, 2026
- Chapter 222: "I want you to."* May 20, 2026
- Chapter 221: Mythic Class May 20, 2026
- Chapter 220: Even Kings Bleed May 20, 2026
- Chapter 219: "You’re not my equal." May 20, 2026
- Chapter 218: Kneel May 20, 2026
- Chapter 217: "You’re a fucking joke." May 20, 2026
- Chapter 216: "No. I’m your correction." May 20, 2026
- Chapter 215: Vrahl’An May 20, 2026
- Chapter 214: "You’re in for the fight of your life." May 20, 2026
- Chapter 213: "The world may burn again." May 20, 2026
- Chapter 212: Reclamation May 20, 2026
- Chapter 211: A Pissed Daniel May 20, 2026
- Chapter 210: "…So close." May 20, 2026
- Chapter 209: Boss Battle 2 May 20, 2026
- Chapter 208: Boss Battle 1 May 20, 2026
- Chapter 207: Blood Domain: Abyssal Variant May 20, 2026
- Chapter 206: Absolute Comma May 20, 2026
- Chapter 205: Clearing The 10 Floors May 20, 2026
- Chapter 204: Fall with me May 20, 2026
- Chapter 203: "It’s complicated." May 20, 2026
- Chapter 202: The Tower May 20, 2026
- Chapter 201: Building The Realm May 20, 2026
- Chapter 200: Bloodline Of Ruin May 20, 2026
- Chapter 199: Addressing The People May 20, 2026
- Chapter 198: Valecar Hatred May 20, 2026
- Chapter 197: The returned King May 20, 2026
- Chapter 196: The Progenitor had returned May 20, 2026
- Chapter 195: The Lords May 20, 2026
- Chapter 194: The King And His Lords (read the next - before May 20, 2026
- Chapter 193: I’m home May 20, 2026
- Chapter 192: You can stay. Or leave. I don’t care May 20, 2026
- Chapter 191: "I’m here to claim what’s mine." May 20, 2026
- Chapter 190: The Throne May 20, 2026
- Chapter 189: "They weren’t strong enough." May 20, 2026
- Chapter 188: "I am." May 20, 2026
- Chapter 187: Move May 20, 2026
- Chapter 186: "So you believe me?" May 20, 2026
- Chapter 185: "…I’m here to end the rot," May 20, 2026
- Chapter 184: "I don’t want war," May 20, 2026
- Chapter 183: Lucifer was still Lucifer May 20, 2026
- Chapter 182: The Vampire Realm May 20, 2026
- Chapter 181: Home May 20, 2026
- Chapter 180: Fight Between Two Progenitors May 20, 2026
- Chapter 179: "Let’s end this farce." May 20, 2026
- Chapter 178: Adam Brat May 20, 2026
- Chapter 177: I Love You May 20, 2026
- Chapter 176: Luna May 20, 2026
- Chapter 175: It is not a request May 20, 2026
- Chapter 174: Son of Michael May 20, 2026
- Chapter 173: Shattered World May 20, 2026
- Chapter 172: Mine May 20, 2026
- Chapter 171: A Promise May 20, 2026
- Chapter 170: Nothing May 20, 2026
- Chapter 169: Enough May 20, 2026
- Chapter 168: Fake Meeting Real May 20, 2026
- Chapter 167: An Echo Meeting The Original May 20, 2026
- Chapter 166: A Grieving Mother May 20, 2026
- Chapter 165: Eden’s Requiem May 20, 2026
- Chapter 164: The Power Of A True Angel May 20, 2026
- Chapter 163: Killing Vladimir May 20, 2026
- Chapter 162: The Death Of A Friend May 20, 2026
- Chapter 161: Round 2 May 20, 2026
- Chapter 160: The Apocalypse Is Here May 20, 2026
- Chapter 159: Fighting Vladimir May 20, 2026
- Chapter 158: Damaris May 20, 2026
- Chapter 157: Awakening May 20, 2026
- Chapter 156: "This is the end for you." May 20, 2026
- Chapter 155: Adam May 20, 2026
- Chapter 154: "Tell them to bring my boy back." May 20, 2026
- Chapter 153: War Of Mankind 4 May 20, 2026
- Chapter 152: War Of Mankind 3 May 20, 2026
- Chapter 151: War Of Mankind 2 May 20, 2026
- Chapter 150: War Of Mankind 1 May 20, 2026
- Chapter 149: Clone’s Encounter May 20, 2026
- Chapter 148: Velath’rein: The Rite of Lineage Echo May 20, 2026
- Chapter 147: Escape May 20, 2026
- Chapter 146: Malakov’s Plan May 20, 2026
- Chapter 145: Looking At The Crimson Grimoire May 20, 2026
- Chapter 144: Reclaiming May 20, 2026
- Chapter 143: Fighting The Ghouls 2 May 20, 2026
- Chapter 142: Fighting The Ghouls 1 May 20, 2026
- Chapter 141: Lucifer’s Suspicion May 20, 2026
- Chapter 140: Bloodline Guild May 20, 2026
- Chapter 139: it’s too much* May 20, 2026
- Chapter 138: I need you inside me* May 20, 2026
- Chapter 137: Lucifer’s Intention May 20, 2026
- Chapter 136: Crimson Grimoire May 20, 2026
- Chapter 135: I want you to live May 20, 2026
- Chapter 134: Kidnapped Luna May 20, 2026
- Chapter 133: Lucifer’s Girl May 20, 2026
- Chapter 132: Interview With The Devil May 20, 2026
- Chapter 131: Project Black Broadcast May 20, 2026
- Chapter 130: The Wrath Of The Origin Clan May 20, 2026
- Chapter 129: "Let’s burn them all." May 20, 2026
- Chapter 128: Fuck, Ella* May 20, 2026
- Chapter 127: Hey Ella* May 20, 2026
- Chapter 126: Then stop losing May 20, 2026
- Chapter 125: Purging May 20, 2026
- Chapter 124: Unlikely Alliance May 20, 2026
- Chapter 123: Cleanup May 20, 2026
- Chapter 122: "I am." May 20, 2026
- Chapter 121: Back To School May 20, 2026
- Chapter 120: Uproars May 20, 2026
- Chapter 119: Agreement May 20, 2026
- Chapter 118: The Summit 3 May 20, 2026
- Chapter 117: The Summit 2 May 20, 2026
- Chapter 116: The Summit 1 May 20, 2026
- Chapter 115: Luna Rae May 20, 2026
- Chapter 114: Making Decisions May 20, 2026
- Chapter 113: Second Evolution May 20, 2026
- Chapter 112: New World May 20, 2026
- Chapter 111: To A New Beginning May 20, 2026
- Chapter 110: “Don’t Call Me That.” May 20, 2026
- Chapter 109: The Adversaries May 20, 2026
- Chapter 108: Lilith Origin May 20, 2026
- Chapter 107: Enough May 20, 2026
- Chapter 106 - 2v1 3 May 20, 2026
- Chapter 105 - 2v1 2 May 20, 2026
- Chapter 104 - 2v1 1 May 20, 2026
- Chapter 103: For The World May 20, 2026
- Chapter 102: Origin Fights Back May 20, 2026
- Chapter 101: The Origin’s Arrive May 20, 2026
- Chapter 100: Remu’s Death 2 May 20, 2026
- Chapter 99: Remu’s Death 1 May 20, 2026
- Chapter 98: Dera’s Conviction May 20, 2026
- Chapter 97: Defeated Remu May 20, 2026
- Chapter 96: “No one touches them but me.” May 20, 2026
- Chapter 95: The Fight Of The Heads May 20, 2026
- Chapter 94: Teemah Is Here For Ruka May 20, 2026
- Chapter 93: Rematch 2 May 20, 2026
- Chapter 92: Rematch 1 May 20, 2026
- Chapter 91: The Origin Gears Up May 20, 2026
- Chapter 90: Rey Pledging His Loyalty May 20, 2026
- Chapter 89: The Tear 2 May 20, 2026
- Chapter 88: The Tear 1 May 20, 2026
- Chapter 87: Origin May 20, 2026
- Chapter 86: The Secrets Of The Realms May 20, 2026
- Chapter 85: Remu’s True Might May 20, 2026
- Chapter 84: Daniel’s Plans May 20, 2026
- Chapter 83: Prison Break 2 May 20, 2026
- Chapter 82: Prison Break 1 May 20, 2026
- Chapter 81: The First Demon May 20, 2026
- Chapter 80: Angered Leaders May 20, 2026
- Chapter 79: Beating Remu May 20, 2026
- Chapter 78: Reality Phantasm May 20, 2026
- Chapter 77: Three Tails May 20, 2026
- Chapter 76: The Power Of Remu May 20, 2026
- Chapter 75: Vina Vs Teemah May 20, 2026
- Chapter 74: Dark Remu May 20, 2026
- Chapter 73: A Stubborn Vina May 20, 2026
- Chapter 72: Temmy Making A Deal With Greta May 20, 2026
- Chapter 71: Dark Witch May 20, 2026
- Chapter 70: Looking For Remu May 20, 2026
- Chapter 69: Back Home May 20, 2026
- Chapter 68: Teemah May 20, 2026
- Chapter 67: Demon King 2 May 20, 2026
- Chapter 66: Demon King 1 May 20, 2026
- Chapter 65: The Voice 2 May 20, 2026
- Chapter 64: The Voice 1 May 20, 2026
- Chapter 63: Killing Drax May 20, 2026
- Chapter 62: Fighting Drax May 20, 2026
- Chapter 61: Lucifer’s Turn 2 May 20, 2026
- Chapter 60: Lucifer’s Turn 1 May 20, 2026
- Chapter 59: Lucifer Stepped In May 20, 2026
- Chapter 58: Ruka’s Fight May 20, 2026
- Chapter 57: Anita’s Fight May 20, 2026
- Chapter 56: Alessia’s Fights May 20, 2026
- Chapter 55: Ambush May 20, 2026
- Chapter 54: Targeting Lucifer May 20, 2026
- Chapter 53: Essence Absorption May 20, 2026
- Chapter 52: Deciding His Fate 2 May 20, 2026
- Chapter 51: Deciding His Fate 1 May 20, 2026
- Chapter 50: Beating Up Lucifer May 20, 2026
- Chapter 49: Pissed Off Lucifer 2 May 20, 2026
- Chapter 48: Pissed Off Lucifer 1 May 20, 2026
- Chapter 47: You’re dead May 20, 2026
- Chapter 46: Brothers May 20, 2026
- Chapter 45: The Truth About Ruka And Lucifer May 20, 2026
- Chapter 44: Sealing An Eight Legged Spider May 20, 2026
- Chapter 43: Fighting A Jorogumo May 20, 2026
- Chapter 42: Nephilim And A Cambion May 20, 2026
- Chapter 41: Ruka 2 May 20, 2026
- Chapter 40: Ruka 1 May 20, 2026
- Chapter 39: Waking Vampire Cores May 20, 2026
- Chapter 38: Meeting Of The Heads 2 May 20, 2026
- Chapter 37: Meeting Of The Heads 1 May 20, 2026
- Chapter 36: Evolution 2 May 20, 2026
- Chapter 35: Evolution 1 May 20, 2026
- Chapter 34: Vina And Rey May 20, 2026
- Chapter 33: First Step May 20, 2026
- Chapter 32: Starting A Clan May 20, 2026
- Chapter 31: Vina May 20, 2026
- Chapter 30: Monster Hunter May 20, 2026
- Chapter 29: Ghul May 20, 2026
- Chapter 28: "I Need To Level Up." May 20, 2026
- Chapter 27: Heavenly Oath May 20, 2026
- Chapter 26: A Shocking Revelation May 20, 2026
- Chapter 25: Getting A Daylight Ring 3 May 20, 2026
- Chapter 24: Getting A Daylight Ring 2 May 20, 2026
- Chapter 23: Spar Fight 2 May 20, 2026
- Chapter 22: Spar Fight 1 May 20, 2026
- Chapter 21: Getting A Daylight Ring 1 May 20, 2026
- Chapter 20: The First Childe 2 May 20, 2026
- Chapter 19: The First Childe 1 May 20, 2026
- Chapter 18: Planning May 20, 2026
- Chapter 17: Progenitor’s Artifacts May 20, 2026
- Chapter 16: Ella Is Back May 20, 2026
- Chapter 15: Marking Ella (R18) May 20, 2026
- Chapter 14: Dominating Ella 2 (R18) May 20, 2026
- Chapter 13: Dominating Ella (R18) May 20, 2026
- Chapter 12: Orientation May 20, 2026
- Chapter 11: Interesting Vampire May 20, 2026
- Chapter 10: Crescent Hill College May 20, 2026
- Chapter 9: Beating Up Ella May 20, 2026
- Chapter 8: Francisca Is Furious May 20, 2026
- Chapter 7: First Kill May 20, 2026
- Chapter 6: The Progenitor Vampire System May 20, 2026
- Chapter 5: The Night 2 May 20, 2026
- Chapter 4: The Night 1 May 20, 2026
- Chapter 3: Secrets Unveiing May 20, 2026
- Chapter 2: A Night Like No Other 1 May 20, 2026
- Chapter 1: The Tales Of Two Friends May 20, 2026
Reviews
0 comments