Synopsis
MASSRELEASE10CHAPTERSONFIRSTNOVEMBER2CHAPTERSDAILY(NOVEMBER)SeraphinaValegrewupunwanted.Anorphanpassedfromonehometoanotheruntilshelearnedthathappyendingswerebestfoundbetweenpages,notinreallife.Byadulthood,shewasabrokewriter,livingoninstantnoodlesandfailedmanuscripts,clingingtodreamsthatneversold.Thenherbestfriendmailedhera“souvenir”—atinyglassbottlesupposedlyholdingphoenixtears.Shelaughed,madeawish,andthenextthingsheknew…shewokeupinanotherworld.Aworldwheredragonsruncorporations,foxspiritsmanagePR,andevengorgonsholdseatsintheboardroom.Andher?She’snoteventheheroine.Justaphoenixsidecharacterandworse,adefectiveone.Asifbeingcannonfodderwasn’tbadenough,theSystemwhispersheronlywayhome:die.Easytosay,butimpossiblewhenphoenixesdon’tstaydead.Everytimesheburnsout,sherisesagain,trappedinthesamecruelloop.Thenthere’sherboss…LucianDrake,theIceDragonCEOwithglacialeyesandareputationastheperfectgentleman.Intheoriginalstory,LucianDrakewasfatedtobetrayher.Hiscarefullyplannedaffectionwasonlyatraptodrawouttherealheroine.Thesystemkeepswarningher:'don’ttrusthim,don’tfallforhim.'Buthowcanshenotwhenhesmileslikethat,whenhisvoicesoftens,whenhissmallestgesturesfeeltoogenuinetobescripted?Sosheletsherselfbelieve,justalittle…thatmaybethisstorycouldchange.Maybethistime,shecouldchangeherroles.Butstorieshaverules.Andwhenthetruthsurfaces,itcutsdeep.Shewasnevertheone.Justasubstitute.Apawninhisplantoluretherealheroineback.Andyet,wheneverythingfallsapart,whenthetruthburnsthroughtheircarefullybuiltlies,Lucianistheoneleftchasingafterthephoenixhebroke.IfSeraphinawantstoescape,she’llhavetosurviveofficepolitics,respawncycles,andalovethatwasnevermeanttobehers.Becauseevenifthecoldestdragonlearnstolovehertoolate...itmightalreadybeherturntoflyaway.[Transmigration][FantasyRomance][EnemiestoLovers][RebirthLoop][SubstituteFemaleLead][ColdCEODragon][PhoenixFL][ChasingHerBack][EmotionalBetrayal][SecondMaleLeadRedemption][SlowBurn]P/s:Thisstoryiswrittenprimarilyinfirst-person(Seraphina’sPOV)withoccasionalthird-personscenesfromLucian’sperspectivetoshoweventsoutsideherknowledge.Expectsarcasm,emotionalchaos,anddragonswithcommunicationissues.
Readers Also Like
My Cold-Hearted Husband Wants Me Back
“I’llclearyourmother’sdebtentirely.Inreturn,you’llmarryme.”“Areyououtofyourmind?DoyoureallythinkI’dagreetosuchanabsurdproposal?...
Shadow Husband:I Have a Hidden SSS-Class System
TheythinkI'mtheweakestHunterinJakarta.E-ranktrash.TheS-rank'suselesshusband.Theydon'tknowIdied.Theydon'tknowIcameback.Andtheyde...
The Dread Knight's Rage
Solomonisastreetorphanwithnothingtohisname.Afterbeingforcedtofleehishomeland,helivesbyscroungingaroundforscrapsandstowingawayon...
Death Game: Starting as a Trickster, Pretending to Be a God
“WhenIthoughtdeathwastheend,Iopenedmyeyesonlytorealize…itwasjustanewbeginning.”Afterbeingkilledbyajuniorhethoughtwasgoingtoconf...
My Weekly Refreshing Mentor Spirit
Afterthecompletionofhiscollegeentranceexamination,XueDilifindsthatwithinhisbodyeveryweekwillrandomlyspawnaMentorSpiritwithgreat...
Lich for Hire
Inthetwilightofhislife,legendarymagicianAmbroseJenkinsfoundhimselfunabletoaffordaPotionofYouth.Thehighelves—thosedamnedbeanspro...
Chapters 147
- Chapter 147: Your Power May 20, 2026
- Chapter 146: Severin’s Scheme May 20, 2026
- Chapter 145: The Truth You Prefer To Live With May 20, 2026
- Chapter 144: The Mark, The Truth May 20, 2026
- Chapter 143: The Mark Of The Chosen Bride May 20, 2026
- Chapter 142: True Or Lies May 20, 2026
- Chapter 141: The Bride Of The Leviathan May 20, 2026
- Chapter 140: Mermaids May 20, 2026
- Chapter 139: What If May 20, 2026
- Chapter 138: Good Or Bad Idea May 20, 2026
- Chapter 137: The Fairies May 20, 2026
- Chapter 136: Too Kind To Hide May 20, 2026
- Chapter 135: Wanted Bride May 20, 2026
- Chapter 134: Married May 20, 2026
- Chapter 133: Side Effect May 20, 2026
- Chapter 132: My Domain May 20, 2026
- Chapter 131: Hard To Kill May 20, 2026
- Chapter 130: The Last Solution May 20, 2026
- Chapter 129: Thalor Veyra May 20, 2026
- Chapter 128: Lady Ellaris May 20, 2026
- Chapter 127: She Changed May 20, 2026
- Chapter 126: Between Two Worlds May 20, 2026
- Chapter 125: A Stupid Deal May 20, 2026
- Chapter 124: The Past May 20, 2026
- Chapter 123: You Are My Everything May 20, 2026
- Chapter 122: Her Complex Emotions May 20, 2026
- Chapter 121: The First Love May 20, 2026
- Chapter 120: You Created Me May 20, 2026
- Chapter 119: My Wife May 20, 2026
- Chapter 118: Severin Drake May 20, 2026
- Chapter 117: Healing is Not Forgetting May 20, 2026
- Chapter 116: Focus On Our Future May 20, 2026
- Chapter 115: The Faces May 20, 2026
- Chapter 114: Seal Inside The Window May 20, 2026
- Chapter 113: His Mother’s feather May 20, 2026
- Chapter 112: Someone Strong Enough To Pull Her Out May 20, 2026
- Chapter 111: Place With No Magic May 20, 2026
- Chapter 110: A Mixed Child May 20, 2026
- Chapter 109: Half Phoenix, Half Dragon May 20, 2026
- Chapter 108: What Kind Of Man Stands Besides Her May 20, 2026
- Chapter 107: True Blood Tears May 20, 2026
- Chapter 106: The Tears Of A Mother May 20, 2026
- Chapter 105: She Choose To Hurt May 20, 2026
- Chapter 104: Live With That Forever May 20, 2026
- Chapter 103: Welcome Back Miss Vale May 20, 2026
- Chapter 102: Something Wrong May 20, 2026
- Chapter 101: A Marble Sphere May 20, 2026
- Chapter 100: Survive To Collect May 20, 2026
- Chapter 99: Two Best Friends May 20, 2026
- Chapter 98: Where Are We? May 20, 2026
- Chapter 97: The Original Celeste Blaze May 20, 2026
- Chapter 96: Stop Trying To Be The Hero May 20, 2026
- Chapter 95: A Battle Against Morality May 20, 2026
- Chapter 94: Pegasus’s Abilities May 20, 2026
- Chapter 93: The Maze (Seraphina’s POV) May 20, 2026
- Chapter 92: The Crack May 20, 2026
- Chapter 91: Luck On Her Side May 20, 2026
- Chapter 90: The Oracle’s Gift May 20, 2026
- Chapter 89: Seal and Bound Inside May 20, 2026
- Chapter 88: Ready To Leave May 20, 2026
- Chapter 87: Climb Out Of Exile May 20, 2026
- Chapter 86: Elyndra—The Fairy May 20, 2026
- Chapter 85: Nice To Meet You Again, Lucian May 20, 2026
- Chapter 84: Pushing To The Limit May 20, 2026
- Chapter 83: When Anger Leads May 20, 2026
- Chapter 82: Your Mother First May 20, 2026
- Chapter 81: The Twin May 20, 2026
- Chapter 80: Not His Daughter May 20, 2026
- Chapter 79: The Fairies May 20, 2026
- Chapter 78: Did You Know From The Start? May 20, 2026
- Chapter 77: The Blaze May 20, 2026
- Chapter 76: Clingy Koala May 20, 2026
- Chapter 75: If One Day You Disappear May 20, 2026
- Chapter 74: Rare Blood Healing May 20, 2026
- Chapter 73: A Way To Return May 20, 2026
- Chapter 72: The Broken Trust May 20, 2026
- Chapter 71: Meet Someone May 20, 2026
- Chapter 70: Nothing Makes Sense May 20, 2026
- Chapter 69: You Drive Me Insane May 20, 2026
- Chapter 68: The Strange Feeling May 20, 2026
- Chapter 67: Eighty-Two Percent May 20, 2026
- Chapter 66: For His Mother May 20, 2026
- Chapter 65: The Meaning Of Tears May 20, 2026
- Chapter 64: The Same Lonely Fool May 20, 2026
- Chapter 63: I’m Not Your Celeste May 20, 2026
- Chapter 62: The Wishing Forest May 20, 2026
- Chapter 61: Just For The Flame May 20, 2026
- Chapter 60: Same Faces May 20, 2026
- Chapter 59: Lady Celeste May 20, 2026
- Chapter 58: The Original Main Characters May 20, 2026
- Chapter 57: Finding Lady Celeste May 20, 2026
- Chapter 56: Twenty - s May 20, 2026
- Chapter 55: It’s Better If No One Knows May 20, 2026
- Chapter 54: Caelora Garden May 20, 2026
- Chapter 53: Outrealm Phoenix May 20, 2026
- Chapter 52: How Old Are You? May 20, 2026
- Chapter 51: Politics. Power. Alliances May 20, 2026
- Chapter 50: Green Flag Pegasus May 20, 2026
- Chapter 49: A Rogue May 20, 2026
- Chapter 48: Flying Castle May 20, 2026
- Chapter 47: Good At Not Getting Attached May 20, 2026
- Chapter 46: Wedding Ring May 20, 2026
- Chapter 45: A Siren May 20, 2026
- Chapter 44: Ex-Fiancée May 20, 2026
- Chapter 43: Leviathan Clan May 20, 2026
- Chapter 42: Honeymoon Phase May 20, 2026
- Chapter 41: Fall In Love May 20, 2026
- Chapter 40: Not By Choice May 20, 2026
- Chapter 39: She Is The Reason May 20, 2026
- Chapter 38: Phoenix Bride May 20, 2026
- Chapter 37: I Wish I Was Special Too May 20, 2026
- Chapter 36: Draconis Heat May 20, 2026
- Chapter 35: Warning ( 18) : Second Day As A Husband and Wife May 20, 2026
- Chapter 34: The Mirage Fair May 20, 2026
- Chapter 33: Type Of Flames May 20, 2026
- Chapter 32: The Forbidden Book May 20, 2026
- Chapter 31: Those Who Demand To Know May 20, 2026
- Chapter 30: The Royal Can of Phoenixes May 20, 2026
- Chapter 29: Never Meant To Be May 20, 2026
- Chapter 28: Wedding- In Unity And Peace May 20, 2026
- Chapter 27: Not A Marriage Alliance May 20, 2026
- Chapter 26: How It’s Always Been May 20, 2026
- Chapter 25: Call Off The Wedding May 20, 2026
- Chapter 24: Three Races That Lead The Way May 20, 2026
- Chapter 23: Who Are You? May 20, 2026
- Chapter 22: Reaching The Goal May 20, 2026
- Chapter 21: Warning : He Is Really Testing The Theory May 20, 2026
- Chapter 20: Let’s Test The Theory May 20, 2026
- Chapter 19: The Aftermath May 20, 2026
- Chapter 18: Ancestor Blood Vows May 20, 2026
- Chapter 17: Emotional Attachment May 20, 2026
- Chapter 16: (3rd POV) Reach Its Limit May 20, 2026
- Chapter 15: Flame Awakening May 20, 2026
- Chapter 14: You Are A Phoenix May 20, 2026
- Chapter 13: Broken Timeline May 20, 2026
- Chapter 12: The Silent Awakening May 20, 2026
- Chapter 11: Ice And Fire May 20, 2026
- Chapter 10: The Main Goal May 20, 2026
- Chapter 9: Cunning Dragon May 20, 2026
- Chapter 8: The System May 20, 2026
- Chapter 7: Sleeping In The Same Room May 20, 2026
- Chapter 6: A Tradition May 20, 2026
- Chapter 5: His Game May 20, 2026
- Chapter 4: The Beginning of Survival May 20, 2026
- Chapter 3: Not A Main Character May 20, 2026
- Chapter 2: Where Am I? May 20, 2026
- Chapter 1: The First Meeting May 20, 2026
Reviews
0 comments