Synopsis
AsoulfromtheEarthtransmigratedandwasrebornasanewlyhatchedlittleblackdragon.Badnews:Hisdragonmotherhasbeentargetedbyahumankingdom,whichhasalreadydispatchedamassivedragon-slayingarmy.Goodnews:HeawakenedaTalent:[Feast]:Convertsalldevouredmatterintobodilygrowth,permanentlyincreasingphysicalstrengthandoverallsize.Whentenstacks,ahundredstacks,tenthousandstacks,andevenahundredthousandstacksof[Feast]areaccumulated…aterrifyingblackdragonthatfeedsonstarsandentireplanesofexistenceisborn.Udi:“I'mgonnaf*ckingEAT,EAT,EAT!”
Readers Also Like
Big Data Cultivation
Asagraduatewithadoubledegreefromaprestigiousuniversity,FengJunsomehowremainsunemployedaftergraduation.Hestrugglesinthecity,buth...
Madam Li’s Identity Is Exposed Again!
Infrontofothers,heisacoldandcallousPresidentofanempire.Young,wealthyandhandsome,heisalsothePrinceCharmingineverywoman’sheart. O...
My Harem of Dangerous and Crazy Women as a Reincarnated Necromancer
[WARNING:R-18|Explicitcontent,graphicviolence,andadultscenes]Markhadamiserablelife.Hediedinthemostpatheticwaypossible.Andwhenhe...
High School of Demon Hunting
Afterthefinalhighschoolexams,ZhengQingdidn’tgotothelong-desiredImperialUniversity.Instead,hepackedhisbags,huggedhisfox,followed...
From the Metropolis to the Strongest in the Cosmos
Onerealm,oneclone.AnordinaryyoungmanfromEarth,startingfromconqueringtheoceans,unknowinglybecomesthestrongestintheCosmos...
Seeking Martial Dao in All Reborn Lives
WhatisMartialDao?Itresidesinfistsandfeet,weaponsandblades.Itisrightinginjustice,strivingforself-improvementwithoutcease.Italsoe...
Chapters 282
- Chapter 282 - 64: The Fallen Legendary Dragon; Tal’s Complet Jun 07, 2026
- Chapter 281 - 64: The Fallen Legendary Dragon; The Completel Jun 07, 2026
- Chapter 280 - 64: The Fallen Legendary Dragon; The Completel Jun 07, 2026
- Chapter 279 - 64: The Fallen Legendary Dragon; The Completel Jun 07, 2026
- Chapter 278 - 63: Eternal Dark God2 Jun 07, 2026
- Chapter 277 - 63: Eternal Dark God Jun 07, 2026
- Chapter 276 - 62: Legendary Defective Product (Part 2) Jun 07, 2026
- Chapter 275 - 62: Legendary Defective Item Jun 07, 2026
- Chapter 274 - 61: Demon Dragon Substitute in Action (Part 2) Jun 07, 2026
- Chapter 273 - 61: Demon Dragon Substitute Dispatched Jun 07, 2026
- Chapter 272 - 60: Deep Sea Strategy; The Kingdom’s Endgame ( Jun 07, 2026
- Chapter 271 - 60: Deep Sea Strategy; The Kingdom’s Final Day Jun 07, 2026
- Chapter 270 - 59: Morgan and Reagent No. 01 (Part 2) Jun 07, 2026
- Chapter 269 - 59: Morgan and Reagent No. 01 Jun 07, 2026
- Chapter 268 - 58: Given the Answer, Yet You Refuse to Believ Jun 02, 2026
- Chapter 267 - 58: Even When Given the Answer, You Refuse to Jun 02, 2026
- Chapter 266 - 57: Natural Unicorn; The Arriving Guest2 Jun 02, 2026
- Chapter 265 - 57: Natural Unicorn; The Arriving Guest Jun 02, 2026
- Chapter 264 - 56: Persuading the Silver-Haired Girl to Becom Jun 02, 2026
- Chapter 263 - 56: Persuading the Silver-Haired Girl to Becom Jun 02, 2026
- Chapter 262 - 55: Event Escalation, Silver Dragon Sandy2 Jun 01, 2026
- Chapter 261 - 55: The Incident Escalates, Silver Dragon Sand May 31, 2026
- Chapter 260 - 54: Solution and Unveiling Sharpness3 May 31, 2026
- Chapter 259 - 54: Solutions and Showing Strength (Part 2) May 31, 2026
- Chapter 258 - 54: Solutions and Displaying Talent May 31, 2026
- Chapter 257 - 53: The Burden of the Three Adventurous Mother May 31, 2026
- Chapter 256 - 53: Adventure of Three Mother Dragons; A Heavy May 31, 2026
- Chapter 255 - 53: Three Adventuring Dragon Daughters; A Heav May 31, 2026
- Chapter 254 - 52: Essence Blood; Offspring3 May 29, 2026
- Chapter 253 - 52: Essence Blood; Offspring2 May 29, 2026
- Chapter 252 - 52: Essence Blood; Offspring May 29, 2026
- Chapter 251 - 51: Gaining a Mount; Succubus Bloodline4 May 29, 2026
- Chapter 250 - 51: Gaining a Mount; Succubus Bloodline3 May 29, 2026
- Chapter 249 - 51: Gaining a Mount; Succubus Bloodline2 May 29, 2026
- Chapter 248 - 51: A Mount Gained; Succubus Bloodline May 29, 2026
- Chapter 247 - 50: Triangular Four-winged Abyss Demon Dragon3 May 29, 2026
- Chapter 246 - 50: Triangular Four-winged Abyss Demon Dragon2 May 29, 2026
- Chapter 245 - 50: Triangular Four-winged Abyss Demon Dragon May 29, 2026
- Chapter 244 - 49: Banquet! Banquet!! Banquet!!!2 May 29, 2026
- Chapter 243 - 49: Banquet! Banquet!! Banquet!!! May 29, 2026
- Chapter 242 - 48: Instructing the Maid Corps (Part 2) May 29, 2026
- Chapter 241 - 48: Instructing the Maid Corps May 29, 2026
- Chapter 240 - 47: The Epic Path; The True Desire Within2 May 29, 2026
- Chapter 239 - 47: The Epic Path; The Innermost Essence of De May 29, 2026
- Chapter 238 - 46: Longing for Freedom; Soaring Elemental Spi May 29, 2026
- Chapter 237 - 46: Longing for Freedom; Elemental Spiritual L May 29, 2026
- Chapter 236 - 45: Za Sowing Seeds; Bloody Battle on the Plai May 29, 2026
- Chapter 235 - 45: Za Sowing Seeds; Bloodbath on the Plain (P May 29, 2026
- Chapter 234 - 45: Za Sowing Seeds; Bloody Battle on the Plai May 29, 2026
- Chapter 233 - 45: Za Sowing Seeds; Bloody Battle on the Plai May 29, 2026
- Chapter 232 - 44: Giants and Giant Dragons3 May 29, 2026
- Chapter 231 - 44: Giants and Giant Dragons (Part 2) May 29, 2026
- Chapter 230 - 44: Giants and Giant Dragons May 29, 2026
- Chapter 229 - 43: Gentle Ups and Downs; Legendary Dragon Rac May 29, 2026
- Chapter 228 - 43: Subdued Ups and Downs; Legendary Dragon Ra May 29, 2026
- Chapter 227 - 43: Gentle Rise and Fall; Legendary Dragon Rac May 29, 2026
- Chapter 226 - 42: Ever-Changing May 29, 2026
- Chapter 225 - 42: Ever-Changing May 29, 2026
- Chapter 224 - 41: Unifying the Dark Forest (Part 3) May 29, 2026
- Chapter 223 - 41: Unifying the Dark Forest (Part 2) May 29, 2026
- Chapter 222 - 41: Unifying the Dark Forest May 29, 2026
- Chapter 221 - 40: Envoy from the Emerald Forest (2) May 29, 2026
- Chapter 220 - 40: Envoy from the Emerald Forest May 29, 2026
- Chapter 219 - 39: Teleportation Altar; The Crimson Nest Emer May 29, 2026
- Chapter 218 - 39: Teleportation Altar; The Crimson Nest Emer May 29, 2026
- Chapter 217 - 39: Teleportation Altar; The Crimson Nest Emer May 29, 2026
- Chapter 216 - 38: The Snake Demon Maiden’s Delicious, Spring May 29, 2026
- Chapter 215 - 38: The Snake Demon Maiden’s Deliciously Sprin May 29, 2026
- Chapter 214 - 38: The Snake Demon Maiden’s Deliciously Sprin May 29, 2026
- Chapter 213 - 37: Metamorphosed Power3 May 29, 2026
- Chapter 212 - 37: Transformed Strength (Part 2) May 29, 2026
- Chapter 211 - 37: Evolved Power May 29, 2026
- Chapter 210 - 36: Abyss Plane - Lava Wasteland May 29, 2026
- Chapter 209 - 35: Rumors (Part 3) May 29, 2026
- Chapter 208 - 35: Rumors (Part 2) May 29, 2026
- Chapter 207 - 35: Rumors May 29, 2026
- Chapter 206 - 34: Red Dragon Envoy from the Crimson Nest (Re May 29, 2026
- Chapter 205 - 34: The Red Dragon Envoy from the Crimson Nest May 29, 2026
- Chapter 204 - 34: The Red Dragon Envoy from the Crimson Nest May 29, 2026
- Chapter 203 - 33: Five Years; Black Wing Nest2 May 29, 2026
- Chapter 202 - 33: Five Years; Black Wing Nest May 29, 2026
- Chapter 201 - 32: Four Arms; Shark Vein; No Eyes4 May 29, 2026
- Chapter 200 - 32: Four Arms; Shark Vein; No Eyes3 May 29, 2026
- Chapter 199 - 32: Four Arms; Shark Vein; No Eyes2 May 20, 2026
- Chapter 198 - 32: Four Arms; Shark Vein; No Eyes May 20, 2026
- Chapter 197 - 31: Lucerne Campaign (Part 2) May 20, 2026
- Chapter 196 - 31: Battle of Lucerne May 20, 2026
- Chapter 195 - 30: Necromancer May 20, 2026
- Chapter 194 - 29: Whiteclaw Beastman Clan; Return to the Gre May 20, 2026
- Chapter 193 - 29: White Claw Beastman Clan; Return to the Gr May 20, 2026
- Chapter 192 - 29: Whiteclaw Beastman Clan; Return to the Gre May 20, 2026
- Chapter 191 - 29: White Claw Beastman Clan; Return to the Gr May 20, 2026
- Chapter 190 - 29: Whiteclaw Beastman Clan; Return to the Gre May 20, 2026
- Chapter 189 - 29: Whiteclaw Beastman Clan; Return to the Gre May 20, 2026
- Chapter 188 - 28: True Dragon and Dragon Beast; Monster City May 20, 2026
- Chapter 187 - 28: True Dragon and Dragon Beast; Monster City May 20, 2026
- Chapter 186 - 28: True Dragon and Dragon Beast; Monster City May 20, 2026
- Chapter 185 - 27: Dragonling’s Growth; Reversed Knight; Rock May 20, 2026
- Chapter 184 - 27: Dragonling Growth; Reversed Knight; Rock D May 20, 2026
- Chapter 183 - 27: Dragonling Growth; Knight Reversal; Rock D May 20, 2026
- Chapter 182 - 27: Dragonling Growth; Inverted Knight; The Ro May 20, 2026
- Chapter 181 - 27: Dragonling Growth; Reversed Knight; Rock D May 20, 2026
- Chapter 180 - 27: Dragonling Growth; Knight Reversal; Rock D May 20, 2026
- Chapter 179 - 26: Establishing the Dragonling Preschool; Ins May 20, 2026
- Chapter 178 - 26: Opening a Dragonling Preschool; Insights i May 20, 2026
- Chapter 177 - 26: Opening the Dragonling Preschool; Power’s May 20, 2026
- Chapter 176 - 26: Establishing the Dragonling Preschool; Pow May 20, 2026
- Chapter 175 - 25: Dragon Beast; Mixed Blood Classification; May 20, 2026
- Chapter 174 - 25: Dragon Beast; Mixed Blood Classification; May 20, 2026
- Chapter 173 - 25: Dragon Beast; Mixed Blood Classification; May 20, 2026
- Chapter 172 - 24: Dragon Egg Hatching3 May 20, 2026
- Chapter 171 - 24: Dragon Egg Hatching (Part 2) May 20, 2026
- Chapter 170 - 24: Dragon Egg Hatching May 20, 2026
- Chapter 169 - 23: Water Dragon Skill; No Urinating or Defeca May 20, 2026
- Chapter 168 - 23: Water Dragon Skill; No Public Urination or May 20, 2026
- Chapter 167 - 23: Water Dragon Skill; No Peeing or Pooping A May 20, 2026
- Chapter 166 - 22: Victory; The Situation; Bat Demon Bloodlin May 20, 2026
- Chapter 165 - 22: Victory; The Situation; Bat Demon Bloodlin May 20, 2026
- Chapter 164 - 22: Victory; The Situation; Bat Demon Bloodlin May 20, 2026
- Chapter 163 - 21: War; Mad Knight; Mutated Magic-like Skill3 May 20, 2026
- Chapter 162 - 21: War; Mad Knight; Mutant Magic-like Skill2 May 20, 2026
- Chapter 161 - 21: War; Mad Knights; Mutated Magic-like Skill May 20, 2026
- Chapter 160 - 20: Dragon Egg Thief; Blazing Lion May 20, 2026
- Chapter 159 - 20: Dragon Egg Thief; Blazing Lion May 20, 2026
- Chapter 158 - 20: Dragon Egg Thief; Blazing Lion May 20, 2026
- Chapter 157 - 20: Dragon Egg Thief; Blazing Lion May 20, 2026
- Chapter 156 - 19: Altered Nature; Green Dragon’s Nest (First May 20, 2026
- Chapter 155 - 19: Changed Nature; Green Dragon’s Nest (First May 20, 2026
- Chapter 154 - 18: Dragon Father; The Right Way Is to Become May 20, 2026
- Chapter 153 - 18: Dragon Father; The Right Way Is to Become May 20, 2026
- Chapter 152 - 18: Dragon Father; The Correct Way Is to Becom May 20, 2026
- Chapter 151 - 18: Dragon Father; The Correct Way Is to Becom May 20, 2026
- Chapter 150 - 17: Black Castle; Offer Your Humble Loyalty May 20, 2026
- Chapter 149 - 17: Black Castle; Present Your Humble Loyalty2 May 20, 2026
- Chapter 148 - 17: Black Castle; Offer Your Humble Loyalty May 20, 2026
- Chapter 147 - 16: The Struggle for Heirs; A Great Ambition ( May 20, 2026
- Chapter 146 - 16: Contention for Heirs; Grand Ambitions May 20, 2026
- Chapter 145 - 15: This Is How Casters Are Used; Dark Nest3 May 20, 2026
- Chapter 144 - 15: This Is How Casters Are Used; Dark Nest2 May 20, 2026
- Chapter 143 - 15: How to Use a Caster; Dark Nest May 20, 2026
- Chapter 142 - 14: Brothers All3 May 20, 2026
- Chapter 141 - 14: Brothers2 May 20, 2026
- Chapter 140 - 14: Brothers All May 20, 2026
- Chapter 139 - 13: Winner Takes All (Part 2) May 20, 2026
- Chapter 138 - 13: Only the Victor Is King May 20, 2026
- Chapter 137 - 12: Signing the Contract (Part 2) May 20, 2026
- Chapter 136 - 12: Signing the Contract May 20, 2026
- Chapter 135 - 11: Strength is Beauty, Power is Greatness; Re May 20, 2026
- Chapter 134 - 11: The Taller, the More Beautiful; the Bigger May 20, 2026
- Chapter 133 - 11: Strength and Beauty, Returning to the Plac May 20, 2026
- Chapter 132 - 10: Rock Dragon3 May 20, 2026
- Chapter 131 - 10: Rock Dragon (Part 2) May 20, 2026
- Chapter 130 - 10: Rock Dragon May 20, 2026
- Chapter 129 - 9: Eugenics and the 130,000 Dragon Nest Army May 20, 2026
- Chapter 128 - 9: Eugenics, 130,000-Strong Dragon Nest Army ( May 20, 2026
- Chapter 127 - 8: The Red Robe Mage Association and Kingdom T May 20, 2026
- Chapter 126 - 7: Three Years (2) May 20, 2026
- Chapter 125 - 7: Three Years May 20, 2026
- Chapter 124 - 6: Void Dragon; Half-Elf (Tragedy)3 May 20, 2026
- Chapter 123 - 6: Void Dragon; Half-Elf (Tragedy) 2 May 20, 2026
- Chapter 122 - 6: Void Dragon; Half-Elf (Tragedy) May 20, 2026
- Chapter 121 - 5: Followers Assembled3 May 20, 2026
- Chapter 120 - 5: Followers Gather (Part 2) May 20, 2026
- Chapter 119 - 5: Gathering of Followers May 20, 2026
- Chapter 118 - 4: Birth of the Demon Eye (Part 3) May 20, 2026
- Chapter 117 - 4: Birth of the Demon Eye (Part 2) May 20, 2026
- Chapter 116 - 4: Birth of the Demon Eye May 20, 2026
- Chapter 115 - 3: Contamination2 May 20, 2026
- Chapter 114 - 3: Contamination May 20, 2026
- Chapter 113 - 2: Red-Eyed (3) May 20, 2026
- Chapter 112 - 2: Envy (2) May 20, 2026
- Chapter 111 - 2: Green-Eyed May 20, 2026
- Chapter 110 - 1: Loyalty · Experiment · Training · Hunt4 May 20, 2026
- Chapter 109 - 1: Loyalty · Experimentation · Training · Hunt May 20, 2026
- Chapter 108 - 1: Loyalty · Experimentation · Training · Hunt May 20, 2026
- Chapter 107 - 1: Loyalty, Experimentation, Training, and Pre May 20, 2026
- Chapter 106: Release Thoughts Sanjiang Reflection May 20, 2026
- Chapter 105 - 98: Conflict May 20, 2026
- Chapter 104 - 97: Ambush May 20, 2026
- Chapter 103 - 96: Dragon Beast May 20, 2026
- Chapter 102 - 95: Subjugation May 20, 2026
- Chapter 101 - 94: Gray-haired Jackal Wolfman May 20, 2026
- Chapter 100 - 93: Young Dragon Heloise vs. Kobold New Genera May 20, 2026
- Chapter 99 - 92: Curtain Falls May 20, 2026
- Chapter 98 - 91: Schemes of Their Own May 20, 2026
- Chapter 97 - 90: The Army Claims the Land May 20, 2026
- Chapter 96 - 89: Impact May 20, 2026
- Chapter 95 - 88: Death Finger May 20, 2026
- Chapter 94 - 87: Legendary Truth May 20, 2026
- Chapter 93 - 86: Three Tasks May 20, 2026
- Chapter 92 - 85: Death Hurricane Knight Order May 20, 2026
- Chapter 91 - 84: Bley, Dragon Nest Guard, and Settling Down May 20, 2026
- Chapter 90 - 83: Battle with the Griffin May 20, 2026
- Chapter 89 - 82: Departure May 20, 2026
- Chapter 88 - 81: Signing the Pact May 20, 2026
- Chapter 87 - 80: Experiments and Dragon Brother and Long Mei May 20, 2026
- Chapter 86 - 79: Northern Domain Expansion May 20, 2026
- Chapter 85 - 78: Heading North May 20, 2026
- Chapter 84 - 77: Dragon-blooded Maid Corps, Turbulence on th May 20, 2026
- Chapter 83 - 76: Slaves, Aegean Beastmen May 20, 2026
- Chapter 82 - 76: Slaves, Aegean Beastmen (4k) May 20, 2026
- Chapter 81 - 75: Four Magic-like Skills, Crimson Milk-toothe May 20, 2026
- Chapter 80 - 75: Four Magic-like Skills, Crimson Milk-toothe May 20, 2026
- Chapter 79 - 74: A Day in the Clan and Growth Stage Slumber May 20, 2026
- Chapter 78 - 74: A Day in the Clan and Growth Stage Slumber May 20, 2026
- Chapter 77 - 74: A Day in the Clan and the Slumber of Growth May 20, 2026
- Chapter 76 - 73: Roy’s Submission May 20, 2026
- Chapter 75 - 73: Roy’s Submission May 20, 2026
- Chapter 74 - 72: A Qualitative Leap (4k)2 May 20, 2026
- Chapter 73 - 72: Qualitative Enhancement May 20, 2026
- Chapter 72 - 71: Three Years of Accumulation May 20, 2026
- Chapter 71 - 70: Magic Crystal Ore May 20, 2026
- Chapter 70 - 69: The Curtain Falls May 20, 2026
- Chapter 69 - 68: Martial Monk - Mountain Faithful May 20, 2026
- Chapter 68 - 67: Advanced Displacement Field May 20, 2026
- Chapter 67 - 66: Clouds of War May 20, 2026
- Chapter 66 - 65: Leanna May 20, 2026
- Chapter 65 - 64: Guilty May 20, 2026
- Chapter 64 - 63: The True Evil Dragon May 20, 2026
- Chapter 63 - 62: The Dragon’s Most Shameless Tactic May 20, 2026
- Chapter 62 - 61: Thorny Situation May 20, 2026
- Chapter 61 - 60: Advanced Combat Power May 20, 2026
- Chapter 60 - 59: Brutal Slaughter May 20, 2026
- Chapter 59 - 58: The Furious Black Dragon Maiden and the Hom May 20, 2026
- Chapter 58 - 57: Retreat May 20, 2026
- Chapter 57 - 56: Surprise Assault May 20, 2026
- Chapter 56 - 55: Undermining the Foundation May 20, 2026
- Chapter 55 - 54: Bone Blood Warrior, Diverting Calamity East May 20, 2026
- Chapter 54 - 53: Covenant and Civilization May 20, 2026
- Chapter 53 - 52: Breaking the Crane’s Will May 20, 2026
- Chapter 52 - 51: Defeat May 20, 2026
- Chapter 51 - 50: White Feathered Owl-tailed Crane May 20, 2026
- Chapter 50 - 49: Master Level Spell Rune May 20, 2026
- Chapter 49 - 48: Captives May 20, 2026
- Chapter 48 - 47: The Battle Ends May 20, 2026
- Chapter 47 - 46: Mondo Is Here to Protect You May 20, 2026
- Chapter 46 - 45: Ambush May 20, 2026
- Chapter 45 - 44: Why Not Just Eat and Eat May 20, 2026
- Chapter 44 - 43: Power Development May 20, 2026
- Chapter 43 - 42: Finally Found May 20, 2026
- Chapter 42 - 41: Wild Dwarves · Sub-dragon Knight May 20, 2026
- Chapter 41 - 40: Half a Year May 20, 2026
- Chapter 40 - 39: Unusual Advancement May 20, 2026
- Chapter 39 - 38: Research Results May 20, 2026
- Chapter 38 - 37: Enhancing Productivity May 20, 2026
- Chapter 37 - 36: The Little Dragon Fakes Long Wei May 20, 2026
- Chapter 36 - 35: The Transaction Process May 20, 2026
- Chapter 35 - 34: Source of Iron Weapons May 20, 2026
- Chapter 34 - 33: Spell Rune May 20, 2026
- Chapter 33 - 32: Mage Class Change May 20, 2026
- Chapter 32 - 31: Professional Book May 20, 2026
- Chapter 31 - 30: Still Too Weak May 20, 2026
- Chapter 30 - 29: Blazing Greatclub May 20, 2026
- Chapter 29 - 28: Tribal Assault Battle May 20, 2026
- Chapter 28 - 27: Assembly May 20, 2026
- Chapter 27 - 26: Goblins and Wild Dwarves’ Tracks May 20, 2026
- Chapter 26 - 25: Brutal Melee May 20, 2026
- Chapter 25 - 24: Mondo Thorn May 20, 2026
- Chapter 24 - 23: Magic Awakening May 20, 2026
- Chapter 23 - 22: Black Blood Tribe May 20, 2026
- Chapter 22 - 21: A Day Worth Remembering May 20, 2026
- Chapter 21 - 18, 19, 20: Giant Demon Gray, Half a Year, Slum May 20, 2026
- Chapter 20 - 18-20: Giant Demon Gray, Half a Year, Slumber a May 20, 2026
- Chapter 19 - 18-20: Giant Demon Gray, Half a Year, Slumber a May 20, 2026
- Chapter 18-20: Giant Demon Gray, Half a Year, Slumber and Aw May 20, 2026
- Chapter 17: Side Effects May 20, 2026
- Chapter 16: Shiji the Kobold – Growth Arc May 20, 2026
- Chapter 15: Abnormal Dragon May 20, 2026
- Chapter 14: Servant Contract May 20, 2026
- Chapter 13: Faction Distribution Around the Dragon Nest May 20, 2026
- Chapter 12: Growth and Trouble May 20, 2026
- Chapter 11: The Future May 20, 2026
- Chapter 10 - 9-10: Terrifying May 20, 2026
- Chapter 9: Terrifying May 20, 2026
- Chapter 8 - 7: Black Dragon Electric Fan May 20, 2026
- Chapter 7-8: Black Dragon Electric Fan (4k) May 20, 2026
- Chapter 6: Kindness May 20, 2026
- Chapter 5: The Decision May 20, 2026
- Chapter 4: The Second Banquet May 20, 2026
- Chapter 3: The Eldest Brother’s Authority May 20, 2026
- Chapter 2: Dragon Brother and Long Mei May 20, 2026
- Chapter 1: Birth and... Banquet May 20, 2026
Reviews
0 comments