Synopsis
Dahilsakanyangnatatangingtadhana,madamingnakasalamuhasiJeterLeenamgaDiyosaatngDemonesskungsaanaynatanggapangkanilangwalangkapantaynapamana,mgadivinepulse,ultimatemartialarts,attransendentalchemytechniques,nanagbigaysakanyangmagandangpaglalakbaysamundongcultivation.Itoaykuwentongpaglalakbayngisangnatatangingalchemisttungosarurokngpaggawangmgamahimalangmgapillsodan.
Readers Also Like
Peerless Medicine God
Hehadonceobtainedahighlevelledmedicalknowledge,martialartsandaSpecialAbilitywhichallowedhimtoseethroughtheotherparty'sthoughts....
The Ethereal Domains
ChaYuen,aremarkablecultivatorinhispreviousexistence,witnessedtheruthlessmachinationsofthethreeformidablefactionswithintheQing-Y...
Reborn in the Eighties as a Housewife with a Space
Afterwakingupfromacaraccident,QinXuerealizedthatshehadtraveledbacktothe1980s,andwhat’sevenmoreshockingisthatthere’saballinherbe...
The Divine Urban Physician
“Serialkillers?AncientMartialArtists?Swordmasters?Idon’tgivearat’s*sswhoyouare!Allwillbowbeforeme!”Fiveyearsago,hisfamilywaswip...
Super Insane Doctor of the Goddess
“Rascal,I’mgoingouttodosomething,soIcan’ttakecareofyouanymore.Youcangodownthemountainandhavefun.Butifyoucan’tfindsomeonewhomatc...
Big Data Cultivation
Asagraduatewithadoubledegreefromaprestigiousuniversity,FengJunsomehowremainsunemployedaftergraduation.Hestrugglesinthecity,buth...
Chapters 1770
- Chapter 1770 - 1770: Exploring the Mysterious Palace in the May 21, 2026
- Chapter 1769 - 1769: Chen Xiang’s Encounter with the Dragon May 21, 2026
- Chapter 1768 - 1768: The Departure of the Gods May 21, 2026
- Chapter 1767 - 1767: The Showdown at the Dragon Vein May 21, 2026
- Chapter 1766 - 1766: The Encounter with the Mei Emperor May 21, 2026
- Chapter 1765 - 1765: The Scene Unfolds May 21, 2026
- Chapter 1764 - 1764: The Arrival of the Fire Emperor May 21, 2026
- Chapter 1763 - 1763: Sacred Secrets: The Fall of the Ice Emp May 21, 2026
- Chapter 1762 - 1762: Sacred Secrets: Revelations of the Divi May 21, 2026
- Chapter 1761 - 1761: Divine Origins: Secrets of the Chaos Re May 21, 2026
- Chapter 1760 - 1760: "Binding Promise: A Dance of Seduction May 21, 2026
- Chapter 1759 - 1759: Journey Through the Chaos Realm May 21, 2026
- Chapter 1758 - 1758: The Miraculous Threefold Yield: Chen Xi May 21, 2026
- Chapter 1757 - 1757: Chen Xiang’s Soul-Lock Counterattack! May 21, 2026
- Chapter 1756 - 1756: Feng Yujie’s Alluring Tactics! May 21, 2026
- Chapter 1755 - 1755: Divine Refining Showdown: Chen Xiang’s May 21, 2026
- Chapter 1754 - 1754: The Divine Feather Emperor’s Challenge: May 21, 2026
- Chapter 1753 - 1753: "Divine Feather Holy Nations: Pill Refi May 21, 2026
- Chapter 1752 - 1752: Alchemy Rivalry: Stakes and Surprises May 21, 2026
- Chapter 1751 - 1751: Reunion at the Abyss: Plans and Promise May 21, 2026
- Chapter 1750 - 1750: Revelation and Resolve: Seeking Justice May 21, 2026
- Chapter 1749 - 1749: Return and Revelation: Di Tian’s Five M May 21, 2026
- Chapter 1748 - 1748: The Azure Dragon’s Farewell May 21, 2026
- Chapter 1747 - 1747: The Dragon’s Promise May 21, 2026
- Chapter 1746 - 1746: Divine Deception May 21, 2026
- Chapter 1745 - 1745: Divine Weapon Revelation May 21, 2026
- Chapter 1744 - 1744: Mastering the Sacred Craft: Chen Xiang’ May 21, 2026
- Chapter 1743 - 1743: Unveiling Chen Xiang’s Innate Ability May 21, 2026
- Chapter 1742 - 1742: Soul Essence Discovery May 21, 2026
- Chapter 1741 - 1741: A Dangerous Game of Trust May 21, 2026
- Chapter 1740 - 1740: Divine Prison Alliances: Fortune and Fr May 21, 2026
- Chapter 1739 - 1739: God-eclipse Powder: Unleashing Divine P May 21, 2026
- Chapter 1738 - 1738: The Battle of Gods and Dragons May 21, 2026
- Chapter 1737 - 1737: The Perilous Path May 21, 2026
- Chapter 1736 - 1736: The Unlikely Alliance May 21, 2026
- Chapter 1735 - 1735: Prison Escape Plan May 21, 2026
- Chapter 1734 - 1734: Divine Deity Conquest May 21, 2026
- Chapter 1733 - 1733: Divine Pursuits: Unraveling Mysteries May 21, 2026
- Chapter 1732 - 1732: Cultivating Power: Chen Xiang’s Journey May 21, 2026
- Chapter 1731 - 1731: Di Tian’s Evolution: A Hundred Years of May 21, 2026
- Chapter 1730 - 1730: Chen Xiang’s Breakthrough: Eight Tiansh May 21, 2026
- Chapter 1729 - 1729: Chen Xiang’s Triumph: Refining the Tian May 21, 2026
- Chapter 1728 - 1728: The Azure Dragon’s Legacy May 21, 2026
- Chapter 1727 - 1727: Revelations of the Divine Realm May 21, 2026
- Chapter 1726 - 1726: Bound by the Divine Prison: A Dragon’s May 21, 2026
- Chapter 1725 - 1725: Divine Prison Redemption May 21, 2026
- Chapter 1724 - 1724: The Old Cyan Bug May 21, 2026
- Chapter 1723 - 1723: The Mystery of Bane Two May 21, 2026
- Chapter 1722 - 1722: Divine Talisman’s Gambit May 21, 2026
- Chapter 1721 - 1721: Fateful Betrayal May 21, 2026
- Chapter 1720 - 1720: Divine Deity Deals May 21, 2026
- Chapter 1719 - 1719: The Mysterious Motive Behind Hell’s Wra May 21, 2026
- Chapter 1718 - 1718: A Race Against Time: Evading Hell’s Gra May 21, 2026
- Chapter 1717 - 1717: A Deceptive Scheme Unveiled May 21, 2026
- Chapter 1716 - 1716: Precautionary Measures: A Warning from May 21, 2026
- Chapter 1715 - 1715: Deals and Discoveries: A Journey into t May 21, 2026
- Chapter 1714 - 1714: Exploring the Market May 21, 2026
- Chapter 1713 - 1713: Inside Feng Shen Native Bank May 21, 2026
- Chapter 1712 - 1712: Gods Realm’s Shadows May 21, 2026
- Chapter 1711 - 1711: The Native Bank: A Deal with the Devil May 21, 2026
- Chapter 1710 - 1710: God’s Punishment Land: A Prison of the May 21, 2026
- Chapter 1709 - 1709: Encounter with Peng Renyi May 21, 2026
- Chapter 1708 - 1708: Chen Xiang’s Revelation May 21, 2026
- Chapter 1707 - 1707: Bound by Punishment: Chen Xiang’s Trial May 21, 2026
- Chapter 1706 - 1706: Cursed Grounds: The God’s Punishment May 21, 2026
- Chapter 1705 - 1705: Death’s Embrace May 21, 2026
- Chapter 1704 - 1704: Journey Into Darkness May 21, 2026
- Chapter 1703 - 1703: Preparing for Battle: Gathering Strengt May 21, 2026
- Chapter 1702 - 1702: A Dangerous Decision May 21, 2026
- Chapter 1701 - 1701: Facing the Arrogant Wolf God May 21, 2026
- Chapter 1700 - 1700: White Tiger vs Arrogant Wolf God May 21, 2026
- Chapter 1699 - 1699: The Heavenly Alchemy: Chen Xiang’s Divi May 21, 2026
- Chapter 1698 - 1698: The Heavenly Alchemy: Chen Xiang’s Divi May 21, 2026
- Chapter 1697 - 1697: The Heavenly Alchemy: Chen Xiang’s Divi May 21, 2026
- Chapter 1696 - 1696: The Heavenly Alchemy: Chen Xiang’s Divi May 21, 2026
- Chapter 1695 - 1695: The Tai Chi Alchemy: Chen Xiang’s Divin May 21, 2026
- Chapter 1694 - 1694: The Tai Chi Revelation: Chen Xiang’s He May 21, 2026
- Chapter 1693 - 1693: Battle within the Enchantment May 21, 2026
- Chapter 1692 - 1692: The Snowy Showdown: Clash with the Empe May 21, 2026
- Chapter 1691 - 1691: Birds of a Feather: Unraveling the Myst May 21, 2026
- Chapter 1690 - 1690: Space Black Iron Quest May 21, 2026
- Chapter 1689 - 1689: Seeking the Rare: Quest for Space Black May 21, 2026
- Chapter 1688 - 1688: Frosty Encounter: Duel in the Cold Wind May 21, 2026
- Chapter 1687 - 1687: The Encounter in Cold Wind Forest May 21, 2026
- Chapter 1686 - 1686: Dangerous Encounters: The Wolf King and May 21, 2026
- Chapter 1685 - 1685: Harvest of the Purple Leaf Forest May 21, 2026
- Chapter 1684 - 1684: Encounter with the Primordial Evil Lion May 21, 2026
- Chapter 1683 - 1683: Mastering the Space Domain May 21, 2026
- Chapter 1682 - 1682: Bloody Battle in the Purple Leaf Forest May 21, 2026
- Chapter 1681 - 1681: Encounters in the Sacred Realm May 21, 2026
- Chapter 1680 - 1680: The Return to Di Tian: Old Friends Reun May 21, 2026
- Chapter 1679 - 1679: Monkeys in the Purple Leaf Forest: Chen May 21, 2026
- Chapter 1678 - 1678: The Battle for Life Forest May 21, 2026
- Chapter 1677 - 1677: Chen Xiang’s Last Stand May 21, 2026
- Chapter 1676 - 1676: Confronting the Hell Devil Troop May 21, 2026
- Chapter 1675 - 1675: Into the Enigmatic Life Forest May 21, 2026
- Chapter 1674 - 1674: Chasing Shadows in the Sacred Water Hea May 21, 2026
- Chapter 1673 - 1673: Trapped in the Floating City May 21, 2026
- Chapter 1672 - 1672: Encounter in the Floating City May 21, 2026
- Chapter 1671 - 1671: Bounty in the Floating City May 21, 2026
- Chapter 1670 - 1670: Floating Life Inn May 21, 2026
- Chapter 1669 - 1669: The Grand City May 21, 2026
- Chapter 1668 - 1668: The Unexpected Visitors May 21, 2026
- Chapter 1667 - 1667: The Tainted Feast May 21, 2026
- Chapter 1666 - 1666: The Unveiled Culinary Artistry May 21, 2026
- Chapter 1665 - 1665: The Grand Feast and the Unraveled Schem May 21, 2026
- Chapter 1664 - 1664: he Dazzling Entry: Long Xueyi’s Feast May 21, 2026
- Chapter 1663 - 1663: City of Skysea: Beneath the Waves May 21, 2026
- Chapter 1662 - 1662: The Floating Houses of the Sacred Water May 21, 2026
- Chapter 1661 - 1661: The Gathering of Sacred Masters May 21, 2026
- Chapter 1660 - 1660: The Four Saint Rulers’ Encounter May 21, 2026
- Chapter 1659 - 1659: The Strange Poison and the White Feathe May 21, 2026
- Chapter 1658 - 1658: Chen Xiang’s Escape May 21, 2026
- Chapter 1657 - 1657: Rescuing the Holy Beasts May 21, 2026
- Chapter 1656 - 1656: Emperor Soul Revelation May 21, 2026
- Chapter 1655 - 1655: Silent Poison, Swift Capture May 21, 2026
- Chapter 1654 - 1654: Chen Xiang’s Pursuit May 21, 2026
- Chapter 1653 - 1653: The Curse of the Hell Devil Envoy May 21, 2026
- Chapter 1652 - 1652: The Encounter with Jiang Shijian May 21, 2026
- Chapter 1651 - 1651: The Encounter with Jiang Shijian May 21, 2026
- Chapter 1650 - 1650: The Hunted Prey May 21, 2026
- Chapter 1649 - 1649: Exploring Nine Spirit Heavenly Sea May 21, 2026
- Chapter 1648 - 1648: Unveiling the Mysterious Portrait May 21, 2026
- Chapter 1647 - 1647: Liuyuan Azure Dan Auction Chaos May 21, 2026
- Chapter 1646 - 1646: Chen Xiang’s Pill Selling Triumph May 21, 2026
- Chapter 1645 - 1645: The Mysterious White Pearl: Summoning t May 21, 2026
- Chapter 1644 - 1644: Seeds of Alliance: Strengthening Bonds May 21, 2026
- Chapter 1643 - 1643: Aligning Forces: Unity Against a Common May 21, 2026
- Chapter 1642 - 1642: Yan City’s Stand: The Power Play Begins May 21, 2026
- Chapter 1641 - 1641: Forging Bonds: The Tale of Fire Souls May 21, 2026
- Chapter 1640 - 1640: The Capture of Hell Bat King May 21, 2026
- Chapter 1639 - 1639: The Invasion of the Hell Devil Bats May 21, 2026
- Chapter 1638 - 1638: The Long Awaited Breakthrough May 21, 2026
- Chapter 1637 - 1637: The Immortal Pill Concoction May 21, 2026
- Chapter 1636 - 1636: The Holy Tree’s Fate May 21, 2026
- Chapter 1635 - 1635: The Standoff with the Eagle Emperor May 21, 2026
- Chapter 1634 - 1634: The Confrontation with the Eagle Empero May 21, 2026
- Chapter 1633 - 1633: Beneath the Sacred Tree: The Frog King’ May 21, 2026
- Chapter 1632 - 1632: Beneath the Sacred Tree: Confrontation May 21, 2026
- Chapter 1631 - 1631: Beneath the Sacred Tree May 21, 2026
- Chapter 1630 - 1630: Unexpected Reunion May 21, 2026
- Chapter 1629 - 1629: Friends in Adversity May 21, 2026
- Chapter 1628 - 1628: Alchemy and Affections May 21, 2026
- Chapter 1627 - 1627: Intimate Alchemical Fusion May 21, 2026
- Chapter 1626 - 1626: Spiritual Alchemy Breakthrough May 21, 2026
- Chapter 1625 - 1625: Spiritual Alchemy Alliance May 21, 2026
- Chapter 1624 - 1624: Devil-killing Summit’s Revival: Night D May 21, 2026
- Chapter 1623 - 1623: Alchemy Fusion: Spirit Liquid Revelatio May 21, 2026
- Chapter 1622 - 1622: Alive Slain Method Revelation May 21, 2026
- Chapter 1621 - 1621: Divine Guidance: Unlocking the Alive Sl May 21, 2026
- Chapter 1620 - 1620: The Darkening of the Devil-killing Summ May 21, 2026
- Chapter 1619 - 1619: Unexpected Reunion May 21, 2026
- Chapter 1618 - 1618: Journey into the Sacred Waters May 21, 2026
- Chapter 1617 - 1617: Sandstorm Revelation May 21, 2026
- Chapter 1616 - 1616: Midnight Revelations May 21, 2026
- Chapter 1615 - 1615: The Only Female Supreme Lord May 21, 2026
- Chapter 1614 - 1614: Reunion in the Divine Refiners’ Hall May 21, 2026
- Chapter 1613 - 1613: The Gathering of Divine Refiners: Chen May 21, 2026
- Chapter 1612 - 1612: Divine Deity and Divine Beasts: Unveili May 21, 2026
- Chapter 1611 - 1611: Reunion and Resolve May 21, 2026
- Chapter 1610 - 1610: Fruit of Mischief: Reunion and Ruckus May 21, 2026
- Chapter 1609 - 1609: Reunion in the White Mountains May 21, 2026
- Chapter 1608 - 1608: Quest for the Fire Unicorn May 21, 2026
- Chapter 1607 - 1607: Birth of a Divine Beast May 21, 2026
- Chapter 1606 - 1606: Secrets of the Heavenly Dragon Realm May 21, 2026
- Chapter 1605 - 1605: The Mysterious Fate of the White Dragon May 21, 2026
- Chapter 1604 - 1604: The Divine Intervention May 21, 2026
- Chapter 1603 - 1603: Divine Intervention: The Arrival of Lv May 21, 2026
- Chapter 1602 - 1602: Victory Amidst Chaos: Chen Xiang’s Triu May 21, 2026
- Chapter 1601 - 1601: Master’s Guidance: Chen Xiang’s Despera May 21, 2026
- Chapter 1600 - 1600: Chen Xiang vs. Heavenly Slave May 21, 2026
- Chapter 1599 - 1599: The arrival of the Dragon Emperor May 21, 2026
- Chapter 1598 - 1598: Heavenly Dragon Race vs. Heavenly Evil May 21, 2026
- Chapter 1597 - 1597: Devil-suppressing Divine Palace vs. Hea May 21, 2026
- Chapter 1596 - 1596: Deceptive Duels: Heavenly Thunder Regio May 21, 2026
- Chapter 1595 - 1595: Battle for Command May 21, 2026
- Chapter 1594 - 1594: Clash of Titans May 21, 2026
- Chapter 1593 - 1593: Reunion and Revelation May 21, 2026
- Chapter 1592 - 1592: Family Bonds May 21, 2026
- Chapter 1591 - 1591: The Puppet Master’s Pawn May 21, 2026
- Chapter 1590 - 1590: The Puppeteers’ Game May 21, 2026
- Chapter 1589 - 1589: Paths of Power and Purpose May 21, 2026
- Chapter 1588 - 1588: Unveiling Divine Power May 21, 2026
- Chapter 1587 - 1587: Battle for Lion Mountain May 21, 2026
- Chapter 1586 - 1586: The Battle of Dragons May 21, 2026
- Chapter 1585 - 1585: The Battle for Lion Mountain May 21, 2026
- Chapter 1584 - 1584: Soul Fusion: The Awakening of Divine De May 21, 2026
- Chapter 1583 - 1583: Refining Divine Deities May 21, 2026
- Chapter 1582 - 1582: Forging Strength: Unveiling the Path to May 21, 2026
- Chapter 1581 - 1581: Awakening the Supreme Lord May 21, 2026
- Chapter 1580 - 1580: Unveiling Secrets: The Legacy of Qi Shi May 21, 2026
- Chapter 1579 - 1579: Jiang Sheng’s Guidance May 21, 2026
- Chapter 1578 - 1578: Unexpected Encounter May 21, 2026
- Chapter 1577 - 1577: Battle of Doppelgangers May 21, 2026
- Chapter 1576 - 1576: Clash of Echoing Spirits May 21, 2026
- Chapter 1575 - 1575: Ascending the Heavenly Stairway May 21, 2026
- Chapter 1574 - 1574: Stairway to Ascendancy May 21, 2026
- Chapter 1573 - 1573: Divine Testaments May 21, 2026
- Chapter 1572 - 1572: Trial of Shadows May 21, 2026
- Chapter 1571 - 1571: Frozen Destiny May 21, 2026
- Chapter 1570 - 1570: Dragon’s Triumph: Clash of Swords May 21, 2026
- Chapter 1569 - 1569: Blade of Dragons: Battling for the Tomb May 21, 2026
- Chapter 1568 - 1568: Inferno in the Ice Plains May 21, 2026
- Chapter 1567 - 1567: Encounter with the Holy Ice Frog May 21, 2026
- Chapter 1566 - 1566: Perilous Encounters: Battling the Eleme May 21, 2026
- Chapter 1565 - 1565: Unveiling Ancient Secrets May 21, 2026
- Chapter 1564 - 1564: Icy Intrigue: Exploring the Ice Emperor May 21, 2026
- Chapter 1563 - 1563: Fifty Kilograms of Holy Stone May 21, 2026
- Chapter 1562 - 1562: The Secrets of Qi Shi and the White Dra May 21, 2026
- Chapter 1561 - 1561: Evil Dragon Graveyard Crisis May 21, 2026
- Chapter 1560 - 1560: Entwined Souls May 21, 2026
- Chapter 1559 - 1559: Unraveling Mysteries May 21, 2026
- Chapter 1558 - 1558: Soulbound Secrets May 21, 2026
- Chapter 1557 - 1557: Forbidden Secrets May 21, 2026
- Chapter 1556 - 1556: Gifts and Promises May 21, 2026
- Chapter 1555 - 1555: Return to Di Tian May 21, 2026
- Chapter 1554 - 1554: Chen Xiang’s Confrontation May 21, 2026
- Chapter 1553 - 1553: The Return of Di Tian May 21, 2026
- Chapter 1552 - 1552: The Ultimate Goal May 21, 2026
- Chapter 1551 - 1551: The Cunning Plan May 21, 2026
- Chapter 1550 - 1550: The Shocking Victory May 21, 2026
- Chapter 1549 - 1549: Chen Xiang, Su Meiyao, and Bai Youyou May 21, 2026
- Chapter 1548 - 1548: Feng Yujie: The Unconventional Leader May 21, 2026
- Chapter 1547 - 1547: Meeting Aunt Feng May 21, 2026
- Chapter 1546 - 1546: A Grand Offering and a Hidden Agenda May 21, 2026
- Chapter 1545 - 1545: Alchemy, Alliances, and Departures May 21, 2026
- Chapter 1544 - 1544: Mastering the Biyuan Dan May 21, 2026
- Chapter 1543 - 1543: Alchemy Endeavors May 21, 2026
- Chapter 1542 - 1542: Poisonous Retribution May 21, 2026
- Chapter 1541 - 1541: Refining Trials and Unexpected Visitors May 21, 2026
- Chapter 1540 - 1540: Unveiling Secrets, Passing Knowledge May 21, 2026
- Chapter 1539 - 1539: Forging Alliances, Seeking Justice May 21, 2026
- Chapter 1538 - 1538: The Encounter: Seeking Red Cloud May 21, 2026
- Chapter 1537 - 1537: Chen Xiang’s Breakthrough May 21, 2026
- Chapter 1536 - 1536: Alchemy and Ambition May 21, 2026
- Chapter 1535 - 1535: Yuxian Dan: Trials and Triumphs May 21, 2026
- Chapter 1534 - 1534: Alchemical Alliance: Trials and Triumph May 21, 2026
- Chapter 1533 - 1533: Alchemy Test May 21, 2026
- Chapter 1532 - 1532: Chen Xiang’s Test at the Three Sunsets May 21, 2026
- Chapter 1531 - 1531: Ji Ling’er’s Escape to the Heaven Sacre May 21, 2026
- Chapter 1530 - 1530: Chen Xiang’s Entry into the Heaven Sacr May 21, 2026
- Chapter 1529 - 1529: Chen Xiang’s Journey with Ji Ling’er May 21, 2026
- Chapter 1528 - 1528: Chen Xiang’s Journey May 21, 2026
- Chapter 1527 - 1527: The Unexpected Turn May 21, 2026
- Chapter 1526 - 1526: Unexpected Guests May 21, 2026
- Chapter 1525 - 1525: Unprecedented Success May 21, 2026
- Chapter 1524 - 1524: Yuling Bamboo Shoots Challenge May 21, 2026
- Chapter 1523 - 1523: Pill Refining Persistence May 21, 2026
- Chapter 1522 - 1522: Alchemy Apprentice’s Strategy May 21, 2026
- Chapter 1521 - 1521: City of Transformations May 21, 2026
- Chapter 1520 - 1520: New Alliances May 21, 2026
- Chapter 1519 - 1519: Birds of a Feather May 21, 2026
- Chapter 1518 - 1518: Escape from the Heavenly Pavilion May 21, 2026
- Chapter 1517 - 1517: Chen Xiang’s Interrogation May 21, 2026
- Chapter 1516 - 1516: Confronting the Mysterious Woman May 21, 2026
- Chapter 1515 - 1515: Unraveling the Sky People’s Defenses May 21, 2026
- Chapter 1514 - 1514: Infiltrating the Sacred Grounds May 21, 2026
- Chapter 1513 - 1513: Stealthy Ambitions: Hunting Holy Stone May 21, 2026
- Chapter 1512 - 1512: Wilderness Encounter: A Cat’s Tale May 21, 2026
- Chapter 1511 - 1511: A Saintly Showdown May 21, 2026
- Chapter 1510 - 1510: A Chilling Encounter May 21, 2026
- Chapter 1509 - 1509: Encounter in the Realm of Flame Heaven May 21, 2026
- Chapter 1508 - 1508: Recovery in the Mountain Cave May 21, 2026
- Chapter 1507 - 1507: Facing the Thunder Tao Double Venerable May 21, 2026
- Chapter 1506 - 1506: Confrontation with the Thunder Tao Doub May 21, 2026
- Chapter 1505 - 1505: Condensing Spirit Liquid Together May 21, 2026
- Chapter 1504 - 1504: A Journey of Recovery May 21, 2026
- Chapter 1503 - 1503: Confronting the Wild Lion Princess May 21, 2026
- Chapter 1502 - 1502: Facing the Ferocious Lions: A Deadly En May 21, 2026
- Chapter 1501 - 1501: Alchemy Secrets and Mischievous Plans May 21, 2026
- Chapter 1500 - 1500: Poisonous Plans Unveiled May 21, 2026
- Chapter 1499 - 1499: The Hundred Flowers Palace Debacle May 21, 2026
- Chapter 1498 - 1498: Chen Xiang’s Gambit May 21, 2026
- Chapter 1497 - 1497: Poisoned Intrigue May 21, 2026
- Chapter 1496 - 1496: Into the Lion’s Den May 21, 2026
- Chapter 1495 - 1495: Rescuing Little Lizhi May 21, 2026
- Chapter 1494 - 1494: Showdown in the Ancient Forest May 21, 2026
- Chapter 1493 - 1493: Unveiling the Barrier May 21, 2026
- Chapter 1492 - 1492: Unveiling the Hidden Realm May 21, 2026
- Chapter 1491 - 1491: Unveiling the Sacred Transformation May 21, 2026
- Chapter 1490 - 1490: Quest to Enter the Heavenly Realm May 21, 2026
- Chapter 1489 - 1489: Chen Xiang’s Determination and Discover May 21, 2026
- Chapter 1488 - 1488: Chen Xiang’s Pill Refinement Journey May 21, 2026
- Chapter 1487 - 1487: Chen Xiang’s Swift Strike May 21, 2026
- Chapter 1486 - 1486: Chen Xiang’s Revenge Plan May 21, 2026
- Chapter 1485 - 1485: The Unforgiven Theft May 21, 2026
- Chapter 1484 - 1484: The Unraveling Conspiracy May 21, 2026
- Chapter 1483 - 1483: Unforeseen Challenges May 21, 2026
- Chapter 1482 - 1482: Unexpected Encounter May 21, 2026
- Chapter 1481 - 1481: Unyielding Standoff May 21, 2026
- Chapter 1480 - 1480: Unexpected Alliance May 21, 2026
- Chapter 1479 - 1479: Evolving Challenges May 21, 2026
- Chapter 1478 - 1478: Trials and Transformations May 21, 2026
- Chapter 1477 - 1477: Unraveling the Evil Star’s Core May 21, 2026
- Chapter 1476 - 1476: Unveiling the Evil Star’s Secret May 21, 2026
- Chapter 1475 - 1475: Ruthless Resolutions May 21, 2026
- Chapter 1474 - 1474: The Conditions May 21, 2026
- Chapter 1473 - 1473: The Ambush May 21, 2026
- Chapter 1472 - 1472: The Hunt for Star Core May 21, 2026
- Chapter 1471 - 1471: The Poisonous Gift May 21, 2026
- Chapter 1470 - 1470: A Stubborn Standoff May 21, 2026
- Chapter 1469 - 1469: Overcoming the Odds May 21, 2026
- Chapter 1468 - 1468: Clash of Titans May 21, 2026
- Chapter 1467 - 1467: Heavenly Emperor’s Lesson May 21, 2026
- Chapter 1466 - 1466: Unveiling the Secrets May 21, 2026
- Chapter 1465 - 1465: The Unraveling Plot May 21, 2026
- Chapter 1464 - 1464: Chen Xiang’s Cunning Moves May 21, 2026
- Chapter 1463 - 1463: Hidden Intentions May 21, 2026
- Chapter 1462 - 1462: Unforeseen Encounters May 21, 2026
- Chapter 1461 - 1461: Arrogance Meets Power May 21, 2026
- Chapter 1460 - 1460: Mastering the Devil’s Strength May 21, 2026
- Chapter 1459 - 1459: Strategic Maneuvers and Sincere Resolve May 21, 2026
- Chapter 1458 - 1458: Revelations and Deceptions May 21, 2026
- Chapter 1457 - 1457: Intriguing Encounters May 21, 2026
- Chapter 1456 - 1456: Secrets Unveiled May 21, 2026
- Chapter 1455 - 1455: The Alive Slain Method Quest May 21, 2026
- Chapter 1454 - 1454: A Lesson in Intrusion May 21, 2026
- Chapter 1453 - 1453: Confrontation with Flower Emperor May 21, 2026
- Chapter 1452 - 1452: The Seed Trade May 21, 2026
- Chapter 1451 - 1451: Seed of Creation May 21, 2026
- Chapter 1450 - 1450: Chen Xiang’s Quest for the Alive Slain May 21, 2026
- Chapter 1449 - 1449: Chen Xiang and Liu Meng’er’s Intimate E May 21, 2026
- Chapter 1448 - 1448: Rescue Amidst Fire: Chen Xiang’s Daring May 21, 2026
- Chapter 1447 - 1447: Chen Xiang’s Determination May 21, 2026
- Chapter 1446 - 1446: Chen Xiang’s Confrontation May 21, 2026
- Chapter 1445 - 1445: Chen Xiang’s Reckoning May 21, 2026
- Chapter 1444 - 1444: The Fall of Heaven Sword City May 21, 2026
- Chapter 1443 - 1443: Chen Xiang’s Divine Fury May 21, 2026
- Chapter 1442 - 1442: Chen Xiang Strikes at Divine Artisan Mo May 21, 2026
- Chapter 1441 - 1441: Breakthrough in the Evil Divine Palace May 21, 2026
- Chapter 1440 - 1440: Bound by Fate May 21, 2026
- Chapter 1439 - 1439: Ripples of Destiny May 21, 2026
- Chapter 1438 - 1438: Legacy of the Evil Emperor May 21, 2026
- Chapter 1437 - 1437: Unveiling the Secrets of the White Jade May 21, 2026
- Chapter 1436 - 1436: The Perilous Trial of the Emperor’s Tom May 21, 2026
- Chapter 1435 - 1435: Under the Shadow of Treachery May 21, 2026
- Chapter 1434 - 1434: Trapped and Targeted May 21, 2026
- Chapter 1433 - 1433: Sibling Showdown May 21, 2026
- Chapter 1432 - 1432: Sister’s Standoff May 21, 2026
- Chapter 1431 - 1431: Evil Suppressing Pagoda Unleashed May 21, 2026
- Chapter 1430 - 1430: Divine Cauldron’s Surprising Capture May 21, 2026
- Chapter 1429 - 1429: Nine Suns: Ominous Portents May 21, 2026
- Chapter 1428 - 1428: Unwelcome Encounters in the Forest May 21, 2026
- Chapter 1427 - 1427: Battling the Beast Tide May 21, 2026
- Chapter 1426 - 1426: Trapped in the Evil Divine Palace May 21, 2026
- Chapter 1425 - 1425: Fire Divine Palace Encounter May 21, 2026
- Chapter 1424 - 1424: Clash in Long Tian May 21, 2026
- Chapter 1423 - 1423: Chen Xiang’s Unexpected Power May 21, 2026
- Chapter 1422 - 1422: Chen Xiang vs. Luo Yitao May 21, 2026
- Chapter 1421 - 1421: An Unwanted Engagement May 21, 2026
- Chapter 1420 - 1420: Journey to Long Tian May 21, 2026
- Chapter 1419 - 1419: Unraveling the Heavenly Sword’s Secrets May 21, 2026
- Chapter 1418 - 1418: Chen Xiang vs Xie Kang May 21, 2026
- Chapter 1417 - 1417: Trial of the Hammersmith May 21, 2026
- Chapter 1416 - 1416: Challenge from Xie Kang May 21, 2026
- Chapter 1415 - 1415: Mystical Sword Strike May 21, 2026
- Chapter 1414 - 1414: Thunderous Showdown: Chen Xiang vs. Xia May 21, 2026
- Chapter 1413 - 1413: Fiery Clash: Fire Dragon Sword vs. Bers May 21, 2026
- Chapter 1412 - 1412: Holy Sword Showdown May 21, 2026
- Chapter 1411 - 1411: Divine Sword Palace Confrontation May 21, 2026
- Chapter 1410 - 1410: Showdown at the Divine Sword Conference May 21, 2026
- Chapter 1409 - 1409: The Sword Soul Legacy May 21, 2026
- Chapter 1408 - 1408 : Sword Soul Revelation May 21, 2026
- Chapter 1407 - 1407: Under Pursuit May 21, 2026
- Chapter 1406 - 1406: Immortal Sword Conference Begins May 21, 2026
- Chapter 1405 - 1405: Unveiling Divine Cauldrons and Mischiev May 21, 2026
- Chapter 1404 - 1404: Secrets and Strategies Unveiled May 21, 2026
- Chapter 1403 - 1403: Reunion and Plans May 21, 2026
- Chapter 1402 - 1402: Human King Immortal Country May 21, 2026
- Chapter 1401 - 1401: Divine Sword Immortal Palace May 21, 2026
- Chapter 1400 - 1400: Journey in the Immortal Palace May 21, 2026
- Chapter 1399 - 1399: Escaping Night Devil’s Territory May 21, 2026
- Chapter 1398 - 1398: Night Devil’s Confrontation May 21, 2026
- Chapter 1397 - 1397: Under the Moon’s Gaze May 21, 2026
- Chapter 1396 - 1396: Descent into Darkness May 21, 2026
- Chapter 1395 - 1395: Breaking Free May 21, 2026
- Chapter 1394 - 1394: Escape Plan May 21, 2026
- Chapter 1393 - 1393: Secrets Unveiled May 21, 2026
- Chapter 1392 - 1392: Avenging Storm May 21, 2026
- Chapter 1391 - 1391: Hidden Strengths May 21, 2026
- Chapter 1390 - 1390: Uncompromising Resolve May 21, 2026
- Chapter 1389 - 1389: Scattered Immortal Trials May 21, 2026
- Chapter 1388 - 1388: Facing the Scattered Immortal Tribulati May 21, 2026
- Chapter 1387 - 1387: Trouble on the Horizon May 21, 2026
- Chapter 1386 - 1386: Feast and Ambitions in Mu Clan May 21, 2026
- Chapter 1385 - 1385: Encounter in Mu Clan May 21, 2026
- Chapter 1384 - 1384: Mu Qianxiang’s Privilege May 21, 2026
- Chapter 1383 - 1383: The Immortal Fruit Discovery May 21, 2026
- Chapter 1382 - 1382: The Valley Intrigue: Chen Xiang’s Arriv May 21, 2026
- Chapter 1381 - 1381: Valley Negotiations: Chen Xiang’s Arriv May 21, 2026
- Chapter 1380 - 1380: Uninvited Encounter May 21, 2026
- Chapter 1379 - 1379: Disturbance Beneath the Stone Mountains May 21, 2026
- Chapter 1378 - 1378: A Race Against the Devouring Force May 21, 2026
- Chapter 1377 - 1377: The Mystery of Endless Rotation May 21, 2026
- Chapter 1376 - 1376: Beware of the Black Tortoise May 21, 2026
- Chapter 1375 - 1375: Encounter in the Enchanted River May 21, 2026
- Chapter 1374 - 1374: Fleeing from the Night Devil Kings May 21, 2026
- Chapter 1373 - 1373: Revelations in Night Devil Hell May 21, 2026
- Chapter 1372 - 1372: Journey Through Night Devil Hell May 21, 2026
- Chapter 1371 - 1371: Night Devil Hell Escape May 21, 2026
- Chapter 1370 - 1370: Race Against Beasts and the Unexpected May 21, 2026
- Chapter 1369 - 1369: Encounter with Night Devils and Night D May 21, 2026
- Chapter 1368 - 1368: Chen Xiang’s Battle Against Night Devil May 21, 2026
- Chapter 1367 - 1367: Chen Xiang’s Desperate Battle May 21, 2026
- Chapter 1366 - 1366: Clash in the Night Devil Hell May 21, 2026
- Chapter 1365 - 1365: Navigating Night Devil Hell May 21, 2026
- Chapter 1364 - 1364: Chasing Shadows in Night Devil Hell May 21, 2026
- Chapter 1363 - 1363: Into Night Devil Hell May 21, 2026
- Chapter 1362 - 1362: Maps and Mysteries: Sacred Beasts Ancie May 21, 2026
- Chapter 1361 - 1361: Sacred Beasts Ancient Realm May 21, 2026
- Chapter 1360 - 1360: Refining the Sacred Animal Dan May 21, 2026
- Chapter 1359 - 1359: Chen Xiang’s Visit to the Long Family May 21, 2026
- Chapter 1358 - 1358: Chen Xiang’s Visit to the Long Family May 21, 2026
- Chapter 1357 - 1357: Chen Xiang’s Unexpected Encounter May 21, 2026
- Chapter 1356 - 1356: Triumph of the Sacred Animal Dan May 21, 2026
- Chapter 1355 - 1355: Chen Xiang’s Chaotic Confrontation May 21, 2026
- Chapter 1354 - 1354: Chen Xiang’s Daring Escape May 21, 2026
- Chapter 1353 - 1353: Radiant Pill Light May 21, 2026
- Chapter 1352 - 1352: Chen Xiang’s Last Stand May 21, 2026
- Chapter 1351 - 1351: Fierce Competition for the Crown May 21, 2026
- Chapter 1350 - 1350: Chen Xiang’s Dazzling Alchemical Triump May 21, 2026
- Chapter 1349 - 1349: Chen Xiang’s Alchemical Mastery May 21, 2026
- Chapter 1348 - 1348: Alchemist’s Battle of Prowess May 21, 2026
- Chapter 1347 - 1347: Chen Xiang’s Defiant Stand May 21, 2026
- Chapter 1346 - 1346: Pill Saint’s Alchemical Triumph May 21, 2026
- Chapter 1345 - 1345: Nine Thousand Pills in Eight Hours May 21, 2026
- Chapter 1344 - 1344: Refining Thirty Pills in One Furnace May 21, 2026
- Chapter 1343 - 1343: Unleashing the Dawan Method May 21, 2026
- Chapter 1342 - 1342: Ground Level Strategy May 21, 2026
- Chapter 1341 - 1341: Ground Level Showdown May 21, 2026
- Chapter 1340 - 1340: Chen Xiang’s Unconventional Path May 21, 2026
- Chapter 1339 - 1339: Chen Xiang’s Unveiled Identity! May 21, 2026
- Chapter 1338 - 1338: Chen Xiang’s Dominance Unleashed! May 21, 2026
- Chapter 1337 - 1337: Chen Xiang’s Sixty Pills in One Furnace May 21, 2026
- Chapter 1336 - 1336: Chen Xiang’s Astonishing Display! May 21, 2026
- Chapter 1335 - 1335: Chen Xiang’s Daring Display May 21, 2026
- Chapter 1334 - 1334: The Alchemical Challenge Begins May 21, 2026
- Chapter 1333 - 1333: The Fateful Cauldron May 21, 2026
- Chapter 1332 - 1332: Unveiling the Pill Competition’s Fierce May 21, 2026
- Chapter 1331 - 1331: Unexpected Companions and Mysterious Me May 21, 2026
- Chapter 1330 - 1330: Secrets, Rivals, and Surprises at Myria May 21, 2026
- Chapter 1329 - 1329: Alchemist Clash in Myriad Dan Immortal May 21, 2026
- Chapter 1328 - 1328: Chen Xiang’s Challenge May 21, 2026
- Chapter 1327 - 1327: Contest of the Hidden Alchemist May 21, 2026
- Chapter 1326 - 1326: Midnight Rendezvous at Wu She Mountain May 21, 2026
- Chapter 1325 - 1325: Triumph and Secrets Unveiled May 21, 2026
- Chapter 1324 - 1324: Tianshan Holy Fruit in the Sixth Prince May 21, 2026
- Chapter 1323 - 1323: Silent Harvest in the Immortal Realm May 21, 2026
- Chapter 1322 - 1322: Venomous Retribution: Dark Embrace May 21, 2026
- Chapter 1321 - 1321: Fires of Retribution May 21, 2026
- Chapter 1320 - 1320: Harvest of Betrayal: Silent Strikes May 21, 2026
- Chapter 1319 - 1319: Throne Battle: Hidden Strikes May 21, 2026
- Chapter 1318 - 1318: Dragon’s Demise, Crystals Arise May 21, 2026
- Chapter 1317 - 1317: The Slap that Echoed in the Ninth Heave May 21, 2026
- Chapter 1316 - 1316: Two Little Emperor Dragons May 21, 2026
- Chapter 1315 - 1315: Battleground Intrigue May 21, 2026
- Chapter 1314 - 1314: A Desperate Escape from Devil-suppressi May 21, 2026
- Chapter 1313 - 1313: A Signal of Secrets May 21, 2026
- Chapter 1312 - 1312: Showdown at Myriad Dan Building May 21, 2026
- Chapter 1311 - 1311: Devil-killing Summit’s Secrets Unveiled May 21, 2026
- Chapter 1310 - 1310: Palace Clash Begins May 21, 2026
- Chapter 1309 - 1309: Palace Secrets Unveiled May 21, 2026
- Chapter 1308 - 1308: Palace Plots and Hidden Alliances May 21, 2026
- Chapter 1307 - 1307: Chen Xiang’s Victory and a Surprise Vis May 21, 2026
- Chapter 1306 - 1306: Chen Xiang’s Astonishing Feat May 21, 2026
- Chapter 1305 - 1305: Alchemical Challenge Unveiled May 21, 2026
- Chapter 1304 - 1304: Alchemist’s Showdown May 21, 2026
- Chapter 1303 - 1303: A Gamble with Life May 21, 2026
- Chapter 1302 - 1302: Unraveling the Mystery of Elder Uncle L May 21, 2026
- Chapter 1301 - 1301: Chen Xiang’s Pact with a Mysterious Imm May 21, 2026
- Chapter 1300 - 1300: Chen Xiang’s Unexpected Ascension May 21, 2026
- Chapter 1299 - 1299: An Unexpected Encounter and the Enigmat May 21, 2026
- Chapter 1298 - 1298: Master’s Shenanigans and the Quest for May 21, 2026
- Chapter 1297 - 1297: Unveiling the Power Struggle May 21, 2026
- Chapter 1296 - 1296: Seeking Pills and Avoiding Intrigue May 21, 2026
- Chapter 1295 - 1295: Guiding the Way with a Finger May 21, 2026
- Chapter 1294 - 1294: A Cure Beyond Companionship May 21, 2026
- Chapter 1293 - 1293: Embarrassing Antidote: The Unlikely Cur May 21, 2026
- Chapter 1292 - 1292: Holy Spirit Rabbit Escape May 21, 2026
- Chapter 1291 - 1291: Beauty and Blades: Alchemical Showdown May 21, 2026
- Chapter 1290 - 1290: The Alchemical Gamble May 21, 2026
- Chapter 1289 - 1289: Pill Auction Turmoil May 21, 2026
- Chapter 1288 - 1288: Underworld Alliance’s Scheme May 21, 2026
- Chapter 1287 - 1287: Jade Rabbit Conspiracy May 21, 2026
- Chapter 1286 - 1286: Heavenly Intrigues May 21, 2026
- Chapter 1285 - 1285: A Hidden Identity May 21, 2026
- Chapter 1284 - 1284: A Dance of Tests May 21, 2026
- Chapter 1283 - 1283: A Mother’s Test, A Daughter’s Grace May 21, 2026
- Chapter 1282 - 1282: A Race Against Time May 21, 2026
- Chapter 1281 - 1281: A Soul-Dispelling Chase May 21, 2026
- Chapter 1280 - 1280: Desperate Escape from Tengu Trio May 21, 2026
- Chapter 1279 - 1279: Feng Clan’s Demand for Sacred Animal Fr May 21, 2026
- Chapter 1278 - 1278: Sacred Animal Fruit in the Heaven Realm May 21, 2026
- Chapter 1277 - 1277: Chen Xiang’s Heaven Realm Journey May 21, 2026
- Chapter 1276 - 1276: Towering Defenses in the Heaven Realm May 21, 2026
- Chapter 1275 - 1275: Divine Soul Awakening May 21, 2026
- Chapter 1274 - 1274: Battling Illusions and Robbery Power May 21, 2026
- Chapter 1273 - 1273: Realm Alliance Talks: Bridging Worlds May 21, 2026
- Chapter 1272 - 1272: A Rapid Nirvana Transformation May 21, 2026
- Chapter 1271 - 1271: Searching for the Blood Pool May 21, 2026
- Chapter 1270 - 1270: Chen Xiang’s Triumph May 21, 2026
- Chapter 1269 - 1269: Chen Xiang’s Return May 21, 2026
- Chapter 1268 - 1268: Reunion in the Ancient Realm May 21, 2026
- Chapter 1267 - 1267: Godly Dragon Vein May 21, 2026
- Chapter 1266 - 1266: Mortal World’s Revelation May 21, 2026
- Chapter 1265 - 1265: Chen Martial’s Call May 21, 2026
- Chapter 1264 - 1264: Dragon’s Legacy of Love May 21, 2026
- Chapter 1263 - 1263: The Journey to Ascension: Leaving a Leg May 21, 2026
- Chapter 1262 - 1262: Creating a Pill Legacy May 21, 2026
- Chapter 1261 - 1261: Journey to the Sacred Beasts Ancient Re May 21, 2026
- Chapter 1260 - 1260: Chen Xiang’s Awakening May 21, 2026
- Chapter 1259 - 1259: Leng Youlan’s Majestic Power May 21, 2026
- Chapter 1258 - 1258: Chen Xiang’s Underground Showdown May 21, 2026
- Chapter 1257 - 1257: Underground Uprising: Unleashing Chaos May 21, 2026
- Chapter 1256 - 1256: Underground Intrigue May 21, 2026
- Chapter 1255 - 1255: Chen Xiang Gathers Allies for the Attac May 21, 2026
- Chapter 1254 - 1254: Chen Xiang Gathers Support for the Atta May 21, 2026
- Chapter 1253 - 1253: Striking First Against Fire Divine Pala May 21, 2026
- Chapter 1252 - 1252: Poachers Beware May 21, 2026
- Chapter 1251 - 1251: Dragon Slaying Clan Vanquished May 21, 2026
- Chapter 1250 - 1250: The Battle Against the Dragon Slaying C May 21, 2026
- Chapter 1249 - 1249: Defending the Dragon Subduing School Ag May 21, 2026
- Chapter 1248 - 1248: Unleashing the Potent Power of Divine F May 21, 2026
- Chapter 1247 - 1247: Unveiling a Multifaceted Mastery of Fla May 21, 2026
- Chapter 1246 - 1246: Chen Xiang’s Quest for the Mysterious T May 21, 2026
- Chapter 1245 - 1245: Clash of Titans and Hidden Schemes May 21, 2026
- Chapter 1244 - 1244: Fire Divine Palace’s Divine Way Expert May 21, 2026
- Chapter 1243 - 1243: Su Meiyao and Bai Youyou’s Mysterious S May 21, 2026
- Chapter 1242 - 1242: Uncovering Divine Devil Cult’s Hidden P May 21, 2026
- Chapter 1241 - 1241: Divine Devil Cult’s Hidden Lair Reveale May 21, 2026
- Chapter 1240 - 1240: Chen Xiang’s Vengeful Pursuit May 21, 2026
- Chapter 1239 - 1239: Chen Xiang’s Vengeance Unleashed May 21, 2026
- Chapter 1238 - 1238: The Battle Against Immortal Realm Adver May 21, 2026
- Chapter 1237 - 1237: Unveiling Shadows: Breaking Free from D May 21, 2026
- Chapter 1236 - 1236: Unveiling Secrets: Clash with the Divin May 21, 2026
- Chapter 1235 - 1235: Icy Wind Valley’s Hidden Secrets May 21, 2026
- Chapter 1234 - 1234: Intimate Reunion and Gathering Storms May 21, 2026
- Chapter 1233 - 1233: Demon’s Fury Unleashed May 21, 2026
- Chapter 1232 - 1232: Ferocious Devil’s Trap Unveiled May 21, 2026
- Chapter 1231 - 1231: Unraveling the Ferocious Devil’s Menace May 21, 2026
- Chapter 1230 - 1230: Unleashing Fury on the Attacked City May 21, 2026
- Chapter 1229 - 1229: The Mysterious Law of the New Imperial May 21, 2026
- Chapter 1228 - 1228: The Map of the Dan Emperor and a Lethal May 21, 2026
- Chapter 1227 - 1227: Dan Emperor’s Map and a Lethal Blood Da May 21, 2026
- Chapter 1226 - 1226: A Revolutionary Pill Refining Technique May 21, 2026
- Chapter 1225 - 1225: Unconventional Pill Refining Technique May 21, 2026
- Chapter 1224 - 1224: Chen Xiang’s Unconventional Approach May 21, 2026
- Chapter 1223 - 1223: Alchemy Duel: Chen Xiang vs Wang Qiongj May 21, 2026
- Chapter 1222 - 1222: Li Baojun’s Triumph and the Challenge f May 21, 2026
- Chapter 1221 - 1221: Li Baojun and Fire Divine Palace’s Fier May 21, 2026
- Chapter 1220 - 1220: Li Baojun’s Steadfast Resolve in the Fa May 21, 2026
- Chapter 1219 - 1219: Chen Xiang Faces a Battle of Wits and P May 21, 2026
- Chapter 1218 - 1218: City in Peril: Chen Xiang Faces a Fiery May 21, 2026
- Chapter 1217 - 1217: Confronting the Fire Divine Palace’s Am May 21, 2026
- Chapter 1216 - 1216: Heaven-Defying Concoction May 21, 2026
- Chapter 1215 - 1215: Unlocking Secrets of Hunyuan Dan May 21, 2026
- Chapter 1214 - 1214: Immortal Kings’ Clash in Devil Realm May 21, 2026
- Chapter 1213 - 1213: Pill Refinement Revolution May 21, 2026
- Chapter 1212 - 1212: Chen Xiang’s Pursuit of God Purificatio May 21, 2026
- Chapter 1211 - 1211: Chen Xiang’s Pursuit of Heaven Level Pi May 21, 2026
- Chapter 1210 - 1210: Death of the Immortal King May 21, 2026
- Chapter 1209 - 1209: Escape from the Fire Divine Palace May 21, 2026
- Chapter 1208 - 1208: Shattering Fire Divine Palace May 21, 2026
- Chapter 1207 - 1207: Volcanic Reckoning May 21, 2026
- Chapter 1206 - 1206: Masked Defiance May 21, 2026
- Chapter 1205 - 1205: Profoundhan Poison Heist May 21, 2026
- Chapter 1204 - 1204: Evil Dragon’s Blood Bargain May 21, 2026
- Chapter 1203 - 1203: Shadowed Alliances May 21, 2026
- Chapter 1202 - 1202: The Arrival of Immortal Monarch May 21, 2026
- Chapter 1201 - 1201: The Shattered Purple profound Holy Moun May 21, 2026
- Chapter 1200 - 1200: Clash of the Titans: Chen Xiang vs. Yan May 21, 2026
- Chapter 1199 - 1199: The Sound Kill Magic Power Unleashed May 21, 2026
- Chapter 1198 - 1198: Infiltrating the Alliance May 21, 2026
- Chapter 1197 - 1197: Betrayal Unveiled: The Duel of Ghost Ki May 21, 2026
- Chapter 1196 - 1196: Continent in Chaos: Unveiling Deception May 21, 2026
- Chapter 1195 - 1195: In Shadows We Trust May 21, 2026
- Chapter 1194 - 1194: Frozen Secrets Unveiled May 21, 2026
- Chapter 1193 - 1193: Beneath the Inferno’s Veil May 21, 2026
- Chapter 1192 - 1192: The Frozen Mystery May 21, 2026
- Chapter 1191 - 1191: Profoundbing Confrontation - Infiltrati May 21, 2026
- Chapter 1190 - 1190: Retribution - Chen Xiang’s Wrath May 21, 2026
- Chapter 1189 - 1189: Life-and-Death Showdown - Chen Xiang vs May 21, 2026
- Chapter 1188 - 1188: The Forging Begins - Chen Xiang’s Metho May 21, 2026
- Chapter 1187 - 1187: Confrontation with Sacred Fire School May 21, 2026
- Chapter 1186 - 1186: Confronting Sacred Fire School May 21, 2026
- Chapter 1185 - 1185: Unveiling the Hidden River of High-Qual May 21, 2026
- Chapter 1184 - 1184: Ice Emperor’s True Power Unveiled May 21, 2026
- Chapter 1183 - 1183: Charges into the Warehouse, Decimating May 21, 2026
- Chapter 1182 - 1182: Hammer of God’s Resonance: Chen Xiang U May 21, 2026
- Chapter 1181 - 1181: Infiltrating the Divine Flames May 21, 2026
- Chapter 1180 - 1180: Ice and Fire Resurgence: Secrets of the May 21, 2026
- Chapter 1179 - 1179: Chen Xiang Escapes and Strikes Back May 21, 2026
- Chapter 1178 - 1178: Chen Xiang’s Breakthrough: Unleashing P May 21, 2026
- Chapter 1177 - 1177: Body of Heavenly Sage Emerges May 21, 2026
- Chapter 1176 - 1176: Refining the Law Enforcement Heaven Spi May 21, 2026
- Chapter 1175 - 1175: Desperate Battle Against the Law Enforc May 21, 2026
- Chapter 1174 - 1174: The Unusual Nirvana Doom and the Growin May 21, 2026
- Chapter 1173 - 1173: Refining Profoundbing and Gathering Pow May 21, 2026
- Chapter 1172 - 1172: Harnessing Nature’s Power for Breakthro May 21, 2026
- Chapter 1171 - 1171: Unexpected Allies, Future Threats, and May 21, 2026
- Chapter 1170 - 1170: Breaking Through Bottlenecks and Unrave May 21, 2026
- Chapter 1169 - 1169: Plans for Escape and the Gathering Stor May 21, 2026
- Chapter 1168 - 1168: Ten-Year Confinement and the Plan for E May 21, 2026
- Chapter 1167 - 1167: Identity Exposed in the Showcase Hall May 21, 2026
- Chapter 1166 - 1166: A Fortuitous Encounter in the Showcase May 21, 2026
- Chapter 1165 - 1165: Gamble on the Gold Dragon Ice May 21, 2026
- Chapter 1164 - 1164: Treasure Hunt in Profound Ice City May 21, 2026
- Chapter 1163 - 1163: The Unsettled World: Chen Xiang’s Chall May 21, 2026
- Chapter 1162 - 1162: The Ice Emperor’s Legacy May 21, 2026
- Chapter 1161 - 1161: Slaying the Evil Snake King May 21, 2026
- Chapter 1160 - 1160: The Triumph over the Serpent Demons May 21, 2026
- Chapter 1159 - 1159: Defying the Evil Snake General May 21, 2026
- Chapter 1158 - 1158: Encounter with the Serpent Demons May 21, 2026
- Chapter 1157 - 1157: Vanishing Profoundbing May 21, 2026
- Chapter 1156 - 1156: Infiltrating the Ice Palace May 21, 2026
- Chapter 1155 - 1155: Secrets of the Fire Divine Palace Revea May 21, 2026
- Chapter 1154 - 1154: Chen Xiang Confronts Fire Divine Palace May 21, 2026
- Chapter 1153 - 1153: Encounter with Fire Divine Palace May 21, 2026
- Chapter 1152 - 1152: Chen Xiang’s Showdown with Little Ape K May 21, 2026
- Chapter 1151 - 1151: Awakening the Little Demoness May 21, 2026
- Chapter 1150 - 1150: The Hidden Gift: Unveiling Ancient Surp May 21, 2026
- Chapter 1149 - 1149: Chen Xiang and Lv Qinlian’s Profoundbin May 21, 2026
- Chapter 1148 - 1148: Poisoned Romance: Chen Xiang’s Encounte May 21, 2026
- Chapter 1147 - 1147: Chen Xiang’s Lucky Encounter with the D May 21, 2026
- Chapter 1146 - 1146: Chen Xiang’s Bold Bet on a Hidden Treas May 21, 2026
- Chapter 1145 - 1145: Chen Xiang’s Encounter with Xue Qianxue May 21, 2026
- Chapter 1144 - 1144: Divine Weapons and Profound Realms May 21, 2026
- Chapter 1143 - 1143: Demonic Bargain: A Standoff in Divine W May 21, 2026
- Chapter 1142 - 1142: Divine Weapons in Peril May 21, 2026
- Chapter 1141 - 1141: Uniting Divine Weapons Heavenly Country May 21, 2026
- Chapter 1140 - 1140: The Divine Weapons Heavenly Country’s C May 21, 2026
- Chapter 1139 - 1139: The Fragrance of Love in Divine Weapons May 21, 2026
- Chapter 1138 - 1138: Trials of the Earthly Core May 21, 2026
- Chapter 1137 - 1137: Unveiling the Earthly Flame’s Secrets May 21, 2026
- Chapter 1136 - 1136: Unraveling the Earth’s Core Mystery May 21, 2026
- Chapter 1135 - 1135: Fiery Liberation: Breaking the Chains May 21, 2026
- Chapter 1134 - 1134: The Might of Spatial Mastery May 21, 2026
- Chapter 1133 - 1133: The Heaven Realm Departure May 21, 2026
- Chapter 1132 - 1132: Ice Dragon’s Wrath May 21, 2026
- Chapter 1131 - 1131: Hammer of Divine Fury May 21, 2026
- Chapter 1130 - 1130: Ice Dragon Sword vs. Fire Dragon Sword May 21, 2026
- Chapter 1129 - 1129: Unveiling the Secrets of Fire Divine Pa May 21, 2026
- Chapter 1128 - 1128: Chen Xiang’s Hammer of God: Unveiling t May 21, 2026
- Chapter 1127 - 1127: Chen Xiang’s Affections Blossom May 21, 2026
- Chapter 1126 - 1126: Ice Dragon Mountain Expedition May 21, 2026
- Chapter 1125 - 1125: Sword Duel: Fire and Ice Clash! May 21, 2026
- Chapter 1124 - 1124: Icy Confrontation: Long Huishan’s Asser May 21, 2026
- Chapter 1123 - 1123: Ice Dragon Sword Unveiled May 21, 2026
- Chapter 1122 - 1122: Divine Encounter in the Cosmic Chest May 21, 2026
- Chapter 1121 - 1121: Long Huishan’s Revenge May 21, 2026
- Chapter 1120 - 1120: Avenging Long Yi: Chen Xiang’s Daring S May 21, 2026
- Chapter 1119 - 1119: Long Huishan’s Retribution May 21, 2026
- Chapter 1118 - 1118: Unveiling the Ancient Alliance - Part I May 21, 2026
- Chapter 1117 - 1117: Unveiling the Ancient Alliance - Part I May 21, 2026
- Chapter 1116 - 1116: Unveiling the Cold Conspiracy May 21, 2026
- Chapter 1115 - 1115: Frosty Perils in the Dragon Cave May 21, 2026
- Chapter 1114 - 1114: Unveiling Identities and Vanquishing th May 21, 2026
- Chapter 1113 - 1113: Ice Dragon’s Dilemma: Chen Xiang’s Risk May 21, 2026
- Chapter 1112 - 1112: Sneaky Savior: Chen Xiang’s Deadly Resc May 21, 2026
- Chapter 1111 - 1111: Drunk God Poison on the Journey to Drag May 21, 2026
- Chapter 1110 - 1110: Betrayal on the Journey to Dragon Cave May 21, 2026
- Chapter 1109 - 1109: Journey to the Dragon Cave May 21, 2026
- Chapter 1108 - 1108: Unveiling the Secrets of the Ice Dragon May 21, 2026
- Chapter 1107 - 1107: Unleashing Fury in the Holy City! May 21, 2026
- Chapter 1106 - 1106: Alchemy Unmasked: Chen Xiang’s Challeng May 21, 2026
- Chapter 1105 - 1105: The Unseen Deal: Pill Mastery May 21, 2026
- Chapter 1104 - 1104: Relive Dan Mastery May 21, 2026
- Chapter 1103 - 1103: Unleashing Divine Potential May 21, 2026
- Chapter 1102 - 1102: Pursuit of High-Grade Ground Level Pill May 21, 2026
- Chapter 1101 - 1101: Poisoned Whispers May 21, 2026
- Chapter 1100 - 1100: Chen Xiang’s Secret Encounter in the Ho May 21, 2026
- Chapter 1099 - 1099: Chen Xiang’s Pursuit in the Sacred Dan May 21, 2026
- Chapter 1098 - 1098: The Unseen Elder of Dragon Subduing Sch May 21, 2026
- Chapter 1097 - 1097: Dragon Emperor’s Pursuit May 21, 2026
- Chapter 1096 - 1096: The Web of Deception May 21, 2026
- Chapter 1095 - 1095: The Great Heist of Chaotic Mountain May 21, 2026
- Chapter 1094 - 1094: Dragon’s Gambit May 21, 2026
- Chapter 1093 - 1093: Dragon’s Endgame May 21, 2026
- Chapter 1092 - 1092: Dragon’s Demise May 21, 2026
- Chapter 1091 - 1091: Dragon’s Challenge May 21, 2026
- Chapter 1090 - 1090: The Origin of the Chaosworld May 21, 2026
- Chapter 1089 - 1089: Chen Xiang’s Battle Against Ice Calamit May 21, 2026
- Chapter 1088 - 1088: A Pill Concoction Challenge May 21, 2026
- Chapter 1087 - 1087: Chen Xiang’s Quest for Strength in the May 21, 2026
- Chapter 1086 - 1086: Chen Xiang’s Struggle in the Chaotic Mo May 21, 2026
- Chapter 1085 - 1085: Chen Xiang’s Devious Infiltration May 21, 2026
- Chapter 1084 - 1084: Opening the Gates to Hidden Secrets May 21, 2026
- Chapter 1083 - 1083: The Secret Threat of Nine Heaven Devil May 21, 2026
- Chapter 1082 - 1082: The Unfolding Mystery of Chaos Fire Tok May 21, 2026
- Chapter 1081 - 1081: Chaos Barbarians and the Drunk God Flow May 21, 2026
- Chapter 1080 - 1080: Mysterious Grass Devoured May 21, 2026
- Chapter 1079 - 1079: Showdown with the Golden Rhinoceros May 21, 2026
- Chapter 1078 - 1078: Journey through the Forest of Chaos May 21, 2026
- Chapter 1077 - 1077: Divine Devil Cult Unveiled May 21, 2026
- Chapter 1076 - 1076: Super Yuan Mountain May 21, 2026
- Chapter 1075 - 1075: Chaotic Mountain Encounter May 21, 2026
- Chapter 1074 - 1074: Chen Xiang Strikes Back May 21, 2026
- Chapter 1073 - 1073: Chen Xiang’s Lone Venture May 21, 2026
- Chapter 1072 - 1072: Fates Intertwined in Zi Lan Valley May 21, 2026
- Chapter 1071 - 1071: Sister in Violet: Embracing New Bonds May 21, 2026
- Chapter 1070 - 1070: Rescue and Reunion May 21, 2026
- Chapter 1069 - 1069: Starfall Reckoning: Dark Intervention May 21, 2026
- Chapter 1068 - 1068: Bane of the Stars: Chen Xiang’s Retribu May 21, 2026
- Chapter 1067 - 1067: Chen Xiang’s Forest Gambit May 21, 2026
- Chapter 1066 - 1066: Chen Xiang’s Alchemical Triumph May 21, 2026
- Chapter 1065 - 1065: Unleashing Chaos Might May 21, 2026
- Chapter 1064 - 1064: Unconventional Refinement Mastery May 21, 2026
- Chapter 1063 - 1063: A Revelation of Thirty May 21, 2026
- Chapter 1062 - 1062: Threefold Miracle May 21, 2026
- Chapter 1061 - 1061: Qi Shen Dan Battle May 21, 2026
- Chapter 1060 - 1060: The Battle for Qi Shen Dan Supremacy May 21, 2026
- Chapter 1059 - 1059: Unveiling the Schemes in Sacred Dan Rea May 21, 2026
- Chapter 1058 - 1058: A Flash of Lightning and a Roaring Flam May 21, 2026
- Chapter 1057 - 1057: Chen Xiang’s Quest for Justice May 21, 2026
- Chapter 1056 - 1056: Chen Xiang Confronts the Dongfang Famil May 21, 2026
- Chapter 1055 - 1055: Chen Xiang Confronts the Poison Dragon’ May 21, 2026
- Chapter 1054 - 1054: Escape in Immortal-poisoning Devil Fore May 21, 2026
- Chapter 1053 - 1053: Hidden Treasures of Sacred Dan Realm May 21, 2026
- Chapter 1052 - 1052: Chen Xiang’s Desperate Escape May 21, 2026
- Chapter 1051 - 1051: Gateway to Di Tian: Alliance and Challe May 21, 2026
- Chapter 1050 - 1050: Sacred Sacrificed Alter Standoff May 21, 2026
- Chapter 1049 - 1049: Journey to the Sacred Sacrificed Alter May 21, 2026
- Chapter 1048 - 1048: Resource Rivalry May 21, 2026
- Chapter 1047 - 1047: Dragon’s Dominance: Claiming Thrones May 21, 2026
- Chapter 1046 - 1046: The White Tiger’s Roar May 21, 2026
- Chapter 1045 - 1045: Chen Xiang’s Audacious Declaration at T May 21, 2026
- Chapter 1044 - 1044: Holy Dragon’s Descent at the Three Real May 21, 2026
- Chapter 1043 - 1043: Unveiling the Power of the Ancient Code May 21, 2026
- Chapter 1042 - 1042: Fusing with the Rule: A Warrior’s Strug May 21, 2026
- Chapter 1041 - 1041: The White Tiger’s Ruthless Retribution May 21, 2026
- Chapter 1040 - 1040: Unveiling the Last Profoundbing’s Secre May 21, 2026
- Chapter 1039 - 1039: The Art of Deception: Chen Xiang’s Auct May 21, 2026
- Chapter 1038 - 1038: Gourd of Wonders: Unveiling the Secrets May 21, 2026
- Chapter 1037 - 1037: Lotus of Mystical Frost: Unveiling the May 21, 2026
- Chapter 1036 - 1036: Dragon’s Secret Unleashed May 21, 2026
- Chapter 1035 - 1035: A Battle Against the Sacred Sacrificed May 21, 2026
- Chapter 1034 - 1034: Mastering the Profoundbing’s Power May 21, 2026
- Chapter 1033 - 1033: Mystical Fusion: Profoundbing and Philo May 21, 2026
- Chapter 1032 - 1032: Philosophic Stone’s Enigma May 21, 2026
- Chapter 1031 - 1031: Spar Scams and Philosophic Stones May 21, 2026
- Chapter 1030 - 1030: Unveiling Profound Treasures May 21, 2026
- Chapter 1029 - 1029: The Grand Bet in the Golden Yang Buildi May 21, 2026
- Chapter 1028 - 1028: Winning Spar and Hearts in the Golden Y May 21, 2026
- Chapter 1027 - 1027: Unraveling the Mystery of Chen Xiang’s May 21, 2026
- Chapter 1026 - 1026: Unraveling the Enigma of Primordial Pro May 21, 2026
- Chapter 1025 - 1025: Unveiling the Secrets of the Profound C May 21, 2026
- Chapter 1024 - 1024: Chen Xiang’s Unveiling of the Profound May 21, 2026
- Chapter 1023 - 1023: Encounter in the Golden Yang Building May 21, 2026
- Chapter 1022 - 1022: White Tiger’s Revelations May 21, 2026
- Chapter 1021 - 1021: The Enigmatic Killing-god Heart May 21, 2026
- Chapter 1020 - 1020: Killing-god Insight: Unveiling the Veil May 21, 2026
- Chapter 1019 - 1019: Dragon Subduing’s Graveyard Fury May 21, 2026
- Chapter 1018 - 1018: Dragon Subduing City’s Fiery Retaliatio May 21, 2026
- Chapter 1017 - 1017: Dragon Subduing City’s Unyielding Stand May 21, 2026
- Chapter 1016 - 1016: Dragon Subduing City’s Triumph May 21, 2026
- Chapter 1015 - 1015: Dragon Subduing Decree: Grounded Intrud May 21, 2026
- Chapter 1014 - 1014: Three Realms Summit: Dragon Subduing’s May 21, 2026
- Chapter 1013 - 1013: Dragon Subduing City Rises: A New Begin May 21, 2026
- Chapter 1012 - 1012: Chen Xiang’s Stand Against the Purple M May 21, 2026
- Chapter 1011 - 1011: Chen Xiang’s Triumph May 21, 2026
- Chapter 1010 - 1010: The Heaven and Earth Killing Method May 21, 2026
- Chapter 1009 - 1009: The Slaughter God’s Hand May 21, 2026
- Chapter 1008 - 1008: Defying the Devil Lord May 21, 2026
- Chapter 1007 - 1007: Refining the Thunderous Beast May 21, 2026
- Chapter 1006 - 1006: Battling the Unseen Robbery Beast May 21, 2026
- Chapter 1005 - 1005: Triumph over Tribulations May 21, 2026
- Chapter 1004 - 1004: Confronting the Mysterious Lightning Ar May 21, 2026
- Chapter 1003 - 1003: Xiao Chou’s Colossal Revelation May 21, 2026
- Chapter 1002 - 1002: Confronting the Formidable Grain Force May 21, 2026
- Chapter 1001 - 1001: Chen Xiang’s Desperate Cultivation May 21, 2026
- Chapter 1000 - 1000: Five Elements Heavenly Fire Tribulation May 21, 2026
- Chapter 999 - 0999: A Divine Alchemical Journey May 21, 2026
- Chapter 998 - 0998: The Divine Fusion Technique May 21, 2026
- Chapter 997 - 0997: The Heaven Thunder Purgatory Crisis May 21, 2026
- Chapter 996 - 0996: The Pill Refining Miracle May 21, 2026
- Chapter 995 - 0995: The Alchemist’s Gaia Feast May 21, 2026
- Chapter 994 - 0994: The Abyss of Torment: Rising from the De May 21, 2026
- Chapter 993 - 0993: Battle Against the Ancient Powers May 21, 2026
- Chapter 992 - 0992: The Awakening of the Demon Lord May 21, 2026
- Chapter 991 - 0991: The Divine Fusion May 21, 2026
- Chapter 990 - 0990: Storming the Sky Demon Bastion: Chen Xia May 21, 2026
- Chapter 989 - 0989: Chen Xiang’s Celestial Triumph May 21, 2026
- Chapter 988 - 0988: Chen Xiang’s Celestial Conquest May 21, 2026
- Chapter 987 - 0987: Sky Demon Showdown May 21, 2026
- Chapter 986 - 0986: The Demon Emperor’s Confrontation: Unmas May 21, 2026
- Chapter 985 - 0985: A Battle with the Demon Emperor May 21, 2026
- Chapter 984 - 0984: Magical Corruption Gas for Holy Lotus Se May 21, 2026
- Chapter 983 - 0983: Qinlian, the Enigmatic Demon Empress May 21, 2026
- Chapter 982 - 0982: Thunder Pond Crisis May 21, 2026
- Chapter 981 - 0981: Battling the Thunder Guardian! May 21, 2026
- Chapter 980 - 0980: Facing the Sky Demon Army in Heaven Thun May 21, 2026
- Chapter 979 - 0979: Navigating the Chaotic Depths! May 21, 2026
- Chapter 978 - 0978: Thunderous Challenge: Fatty’s Shocking R May 21, 2026
- Chapter 977 - 0977: Thunderous Trials: Baptism in the Thunde May 21, 2026
- Chapter 976 - 0976: Dragon Subduing School’s Rise: Gathering May 21, 2026
- Chapter 975 - 0975: Gu Dongchen Caught in a Dilemma May 21, 2026
- Chapter 974 - 0974: Chen Xiang’s Audacious Victory May 21, 2026
- Chapter 973 - 0973: Purge of the Oppressors: Chen Xiang’s Re May 21, 2026
- Chapter 972 - 0972: Heaven Thunder Purgatory Revelation May 21, 2026
- Chapter 971 - 0971: The Purgatory Encounter May 21, 2026
- Chapter 970 - 0970: The Purgatory Confrontation May 21, 2026
- Chapter 969 - 0969: The Tomb Robber’s Revelation May 21, 2026
- Chapter 968 - 0968: Chasing Shadows: Unlikely Companions May 21, 2026
- Chapter 967 - 0967: Void Duel: Unleashing Dragon Power May 21, 2026
- Chapter 966 - 0966: Peach Blossom Imperial Land’s Grand Elde May 21, 2026
- Chapter 965 - 0965: Peach Blossom Imperial Land’s Grand Elde May 21, 2026
- Chapter 964 - 0964: Pill of the Unreal Ghost Eagle (Part 3) May 21, 2026
- Chapter 963 - 0963: Pill of the Unreal Ghost Eagle (Part 2) May 21, 2026
- Chapter 962 - 0962: Pill of the Unreal Ghost Eagle (Part 1) May 21, 2026
- Chapter 961 - 0961: Chen Xiang’s Shadow Shift: Unseen Maneuv May 21, 2026
- Chapter 960 - 0960: Primordial Pill God May 21, 2026
- Chapter 959 - 0959: Chen Xiang’s Divine Retribution: Unleash May 21, 2026
- Chapter 958 - 0958: Chen Xiang’s Fierce Confrontation May 21, 2026
- Chapter 957 - 0957: Chen Xiang vs. Heaven Devil King May 21, 2026
- Chapter 956 - 0956: Purgatory Sky Demon May 21, 2026
- Chapter 955 - 0955: The Heaven Thunder Purgatory May 21, 2026
- Chapter 954 - 0954: The Divine Dragon’s Revolt May 21, 2026
- Chapter 953 - 0953: The Rebellion of Heaven Thunder Purgator May 21, 2026
- Chapter 952 - 0952: Heaven Thunder Purgatory’s Arrival May 21, 2026
- Chapter 951 - 0951: Unveiling Secrets in the Dragon Subduing May 21, 2026
- Chapter 950 - 0950: Quest in Heaven Thunder Purgatory May 21, 2026
- Chapter 949 - 0949: Dragon Subduing School’s Rise May 21, 2026
- Chapter 948 - 0948: Forge of the Earth’s Core May 21, 2026
- Chapter 947 - 0947: Dragon Subduing’s Defiant Stand May 21, 2026
- Chapter 946 - 0946: Dragon Subduing vs. Feng Clan May 21, 2026
- Chapter 945 - 0945: Burning Fury in Pill City May 21, 2026
- Chapter 944 - 0944: Pill City Turmoil May 21, 2026
- Chapter 943 - 0943: Chen Xiang Challenges Elder Li Baojun May 21, 2026
- Chapter 942 - 0942: Tomb Raider Duan Sanchang Joins the Myst May 21, 2026
- Chapter 941 - 0941: Dragon Subduing School’s Mischief Unleas May 21, 2026
- Chapter 940 - 0940: Chen Xiang’s Deceptive Rescue May 21, 2026
- Chapter 939 - 0939: Rescue Mission May 21, 2026
- Chapter 938 - 0938: Bold Rescue Mission in Flying Immortal S May 21, 2026
- Chapter 937 - 0937: A Plot to Foil Flying Immortal School’s May 21, 2026
- Chapter 936 - 0936: Fiery Confrontation: City Lord’s Meltdow May 21, 2026
- Chapter 935 - 0935: Brawl in the Beast Shop May 21, 2026
- Chapter 934 - 0934: Longevity Fruit vs Eternal Dan: Auction May 21, 2026
- Chapter 933 - 0933: Dragon Subduing Dan Hall: Alchemy Showdo May 21, 2026
- Chapter 932 - 0932: Divine Secret of the Abyss May 21, 2026
- Chapter 931 - 0931: Dragon Vein Revelation May 21, 2026
- Chapter 930 - 0930: The Ascension of the Dragon Emperor May 21, 2026
- Chapter 929 - 0929: Sky Emperor’s Confluence May 21, 2026
- Chapter 928 - 0928: Dragon’s Conquest: The Emperor’s Path May 21, 2026
- Chapter 927 - 0927: Dragon’s Gate Unlocked: The Imperial Pat May 21, 2026
- Chapter 926 - 0926: Spiritual Descent into the Dragon’s Vein May 21, 2026
- Chapter 925 - 0925: Dragon’s Vein Unveiled May 21, 2026
- Chapter 924 - 0924: Journey through the Flames May 21, 2026
- Chapter 923 - 0923: A Descent into the Core of the Earth and May 21, 2026
- Chapter 922 - 0922: Journey to the Heart of the Super Mine May 21, 2026
- Chapter 921 - 0921: Li Baojun’s Kylin Fan Unleashed! May 21, 2026
- Chapter 920 - 0920: Recruiting a Dan King May 21, 2026
- Chapter 919 - 0919: Chen Xiang’s Breakthrough in Pill Refini May 21, 2026
- Chapter 918 - 0918: Longevity Fruit Master Emerges! May 21, 2026
- Chapter 917 - 0917: Heavenly Alchemy and Dawan Refining Meth May 21, 2026
- Chapter 916 - 0916: Chen Xiang’s Plan with the Longevity Fru May 21, 2026
- Chapter 915 - 0915: The White Tiger’s Guilt and Chen Xiang’s May 21, 2026
- Chapter 914 - 0914: Reunion with Bai Zhan and Bai Zhenzhen May 21, 2026
- Chapter 913 - 0913: Devil-subduing College’s Principal Zuo Z May 21, 2026
- Chapter 912 - 0912: Three Realms Summit: A Gathering of Powe May 21, 2026
- Chapter 911 - 0911: Unlocking the Secrets of Lion Mountain May 21, 2026
- Chapter 910 - 0910: Breaking Free in the Emperor’s Tomb May 21, 2026
- Chapter 909 - 0909: Treacherous Encounters in the Emperor’s May 21, 2026
- Chapter 908 - 0908: The Battle for the Emperor’s Tomb May 21, 2026
- Chapter 907 - 0907: Celestial Jade Transaction May 21, 2026
- Chapter 906 - 0906: Worldly Chessboard May 21, 2026
- Chapter 905 - 0905: Avenge and Subjugate May 21, 2026
- Chapter 904 - 0904: Seizing Souls and Devouring Power May 21, 2026
- Chapter 903 - 0903: Unleashing the Hidden Trap May 21, 2026
- Chapter 902 - 0902: Desperation’s Deception: A Cunning Trap May 21, 2026
- Chapter 901 - 0901: Race for the Caomu heavenly Dan May 21, 2026
- Chapter 900 - 0900: Yanlong Furnace and Lion Mountain Trials May 21, 2026
- Chapter 899 - 0899: Divine Pills in the Emperor’s Tomb: Chen May 21, 2026
- Chapter 898 - 0898: Bluffing with the Power of the Ten Heave May 21, 2026
- Chapter 897 - 0897: Facing Divine Pursuers and Unraveling Li May 21, 2026
- Chapter 896 - 0896: Sea of Blood and Divine Pursuers in Prof May 21, 2026
- Chapter 895 - 0895: Chen Xiang’s Daring Move May 21, 2026
- Chapter 894 - 0894: Shaking the Pill World and Escaping the May 21, 2026
- Chapter 893 - 0893: Defeating Deceit and Facing City Lord Lu May 21, 2026
- Chapter 892 - 0892: Li Renshan Exposes Ling Xian Shop’s Dece May 21, 2026
- Chapter 891 - 0891: Divine Blade Showdown in Green Summit Ci May 21, 2026
- Chapter 890 - 0890: Punishing Arrogant Elites and Unmasking May 21, 2026
- Chapter 889 - 0889: Stirring Trouble in the South with Chen May 21, 2026
- Chapter 888 - 0888: The Perilous Super Old Sacred Land and H May 21, 2026
- Chapter 887 - 0887: Unveiling the Past, Planning the Future May 21, 2026
- Chapter 886 - 0886: Stirring Ancient Powers and the Mysterio May 21, 2026
- Chapter 885 - 0885: Green Dragon Demon-Slain Broadsword Unve May 21, 2026
- Chapter 884 - 0884: Unleashing Magical Corruption Gas and Fa May 21, 2026
- Chapter 883 - 0883: Magical Corruption Gas Unleashed May 21, 2026
- Chapter 882 - 0882: Unexpected Allies May 21, 2026
- Chapter 881 - 0881: Showdown in the Forest May 21, 2026
- Chapter 880 - 0880: Strategic Moves May 21, 2026
- Chapter 879 - 0879: Blood Bonds and Oath Sworn May 21, 2026
- Chapter 878 - 0878: Chen Xiang’s Unexpected Connection with May 21, 2026
- Chapter 877 - 0877: Unexpected Reunion May 21, 2026
- Chapter 876 - 0876: Chen Xiang Strikes a Bargain with Lan Ca May 21, 2026
- Chapter 875 - 0875: Clever Bargaining with Lan Cang May 21, 2026
- Chapter 874 - 0874: Chen Xiang’s Supreme Seal vs. Ji Meixian May 21, 2026
- Chapter 873 - 0873: Chen Xiang vs. Ji Meixian (Part 3) May 21, 2026
- Chapter 872 - 0872: Chen Xiang vs. Ji Meixian (Part 2) May 21, 2026
- Chapter 871 - 0871: Chen Xiang vs. Ji Meixian (Part 1) May 21, 2026
- Chapter 870 - 0870: Duel of Fate between Chen Xiang and Ji M May 21, 2026
- Chapter 869 - 0869: Confrontation with Ji Meixian May 21, 2026
- Chapter 868 - 0868: Ruthless Confrontation with the Heavenly May 21, 2026
- Chapter 867 - 0867: The Power of Ten Thousand Mountains May 21, 2026
- Chapter 866 - 0866: A Clash of Young Talents May 21, 2026
- Chapter 865 - 0865: The Battle for the Priceless Steed May 21, 2026
- Chapter 864 - 0864: Journey into the Ground Killing May 21, 2026
- Chapter 863 - 0863: A Journey Through Primordial Times May 21, 2026
- Chapter 862 - 0862: Mastering Immortal Devil Body and Birth May 21, 2026
- Chapter 861 - 0861: Chen Xiang’s Triumph over the Powerful F May 21, 2026
- Chapter 860 - 0860: Declaration of Vengeance May 21, 2026
- Chapter 859 - 0859: Encounter in the Fire Realm May 21, 2026
- Chapter 858 - 0858: Wu Qianqian’s Gentle Healing May 21, 2026
- Chapter 857 - 0857: In Search of the Mysterious Flame Core May 21, 2026
- Chapter 856 - 0856: Yun Xiaodao’s Comedic Encounter with the May 21, 2026
- Chapter 855 - 0855: Friend or Foe May 21, 2026
- Chapter 854 - 0854: Fiery Encounters in the Human Realm May 21, 2026
- Chapter 853 - 0853: Bold Quest for a Thousand Batches of Iro May 21, 2026
- Chapter 852 - 0852: Women Warriors Clash and the Power of Tr May 21, 2026
- Chapter 851 - 0851: Ancient Powers Rise and Chen Xiang’s Mys May 21, 2026
- Chapter 850 - 0850: Pursuit of Power Continues May 21, 2026
- Chapter 849 - 0849: Chaos in Pill City: Li Tianjun’s Success May 21, 2026
- Chapter 848 - 0848: Gu Dongchen’s Bold Move: Shaking Pill Ci May 21, 2026
- Chapter 847 - 0847: Ancient Powers and the Heavenly Earth Ki May 21, 2026
- Chapter 846 - 0846: A Spirited Encounter with Hua Xiangyue May 21, 2026
- Chapter 845 - 0845: Beauty Dan Triumph and a Pill Shop Acqui May 21, 2026
- Chapter 844 - 0844: Heaven Earth Killing Method and Peach Bl May 21, 2026
- Chapter 843 - 0843: Unraveling the Masterful Deception in Pi May 21, 2026
- Chapter 842 - 0842: Astonishing Alchemy Skills Shock the Pil May 21, 2026
- Chapter 841 - 0841: High-Stakes Gamble May 21, 2026
- Chapter 840 - 0840: Chen Xiang’s Audacious Wager May 21, 2026
- Chapter 839 - 0839: The Astonishing Iron Bone Dan Triumph May 21, 2026
- Chapter 838 - 0838: A Showdown with the Dan King May 21, 2026
- Chapter 837 - 0837: Astonishing Gamble at the Pill Shop May 21, 2026
- Chapter 836 - 0836: Daring Gamble May 21, 2026
- Chapter 835 - 0835: Audacious Actions in the Pill Shop May 21, 2026
- Chapter 834 - 0834: Continued Alchemical Triumphs and Confro May 21, 2026
- Chapter 833 - 0833: Mastering Second Stage Foreseeing Alchem May 21, 2026
- Chapter 832 - 0832: Foreseeing Alchemy Mastery Unlocks God-r May 21, 2026
- Chapter 831 - 0831: Clash with Dan King’s Heir! May 21, 2026
- Chapter 830 - 0830: Chen Xiang’s Bold Move May 21, 2026
- Chapter 829 - 0829: Unleashing the Purgatory Tornado and Dra May 21, 2026
- Chapter 828 - 0828: A Showdown with Heavenly Sons and Ladies May 21, 2026
- Chapter 827 - 0827: Astonishing Spiritual Energy Absorption May 21, 2026
- Chapter 826 - 0826: Unprecedented Congenital Jiuyuan Dan wit May 21, 2026
- Chapter 825 - 0825: Attempt at Congenital Jiuyuan Dan with S May 21, 2026
- Chapter 824 - 0824: Encounter with Ji Meixian May 21, 2026
- Chapter 823 - 0823: Ten Heavenly Sacred Mountain and the Eni May 21, 2026
- Chapter 822 - 0822: Lion Mountain’s Secrets and the Unraveli May 21, 2026
- Chapter 821 - 0821: Lion Mountain’s Mystery and Green Summit May 21, 2026
- Chapter 820 - 0820: Uncovering the Cursed Legacy May 21, 2026
- Chapter 819 - 0819: Unleashing the Ancient Beasts May 21, 2026
- Chapter 818 - 0818: Awakening the Ancient Wasteland: A Heave May 21, 2026
- Chapter 817 - 0817: A Battle for Memories and Dignity May 21, 2026
- Chapter 816 - 0816: The Quest for the Immortal Cloak May 21, 2026
- Chapter 815 - 0815: Clash of Powers: Humiliating the Heavenl May 21, 2026
- Chapter 814 - 0814: Angry Dragon Slay: Clash of Powers May 21, 2026
- Chapter 813 - 0813: Confrontation with the Heavenly Maiden B May 21, 2026
- Chapter 812 - 0812: Entangled with the Heavenly Maiden Bai H May 21, 2026
- Chapter 811 - 0811: Encounter with the Heavenly Maiden Bai H May 21, 2026
- Chapter 810 - 0810: Retribution on Display: Heads Nailed to May 21, 2026
- Chapter 809 - 0809: Fateful Clash: Chen Xiang’s Vow May 21, 2026
- Chapter 808 - 0808: White Sea Imperial Land vs Qin Clan May 21, 2026
- Chapter 807 - 0807: The White Sea Imperial Land’s Wrath May 21, 2026
- Chapter 806 - 0806: Unearthing the Secrets: Chen Xiang’s Enc May 21, 2026
- Chapter 805 - 0805: Showdown in the Square: Chen Xiang’s Fie May 21, 2026
- Chapter 804 - 0804: Seeking Fortune in the New World’s Dange May 21, 2026
- Chapter 803 - 0803: Merging Realms and Power Struggles May 21, 2026
- Chapter 802 - 0802: Super Martial School’s Retaliation: Clas May 21, 2026
- Chapter 801 - 0801: Battle Against Arrogance May 21, 2026
- Chapter 800 - 0800: Chen Xiang’s Retribution May 21, 2026
- Chapter 799 - 0799: Confrontation with the Feng Clan May 21, 2026
- Chapter 798 - 0798: Confrontation with the Tong Tian Aristoc May 21, 2026
- Chapter 797 - 0797: Duel with a Tong Tian Aristocratic Famil May 21, 2026
- Chapter 796 - 0796: Chen Xiang’s Mystical Transformation and May 21, 2026
- Chapter 795 - 0795: "Chen Xiang’s Mystical Fusion and the Ri May 21, 2026
- Chapter 794 - 0794: Chen Xiang’s Triumph and the Mysterious May 21, 2026
- Chapter 793 - 0793: Dancing with the Golden Fireball May 21, 2026
- Chapter 792 - 0792: The Golden Sun’s Wrath May 21, 2026
- Chapter 791 - 0791: Unprecedented Nirvana Doom! May 21, 2026
- Chapter 790 - 0790: The Unleashed Wrath of the Ancient Waste May 21, 2026
- Chapter 789 - 0789: A Fateful Encounter in the Forbidden Lan May 21, 2026
- Chapter 788 - 0788: Ancient Desolation Forbidden Land: Pursu May 21, 2026
- Chapter 787 - 0787: Encounter with Jiang Liguang May 21, 2026
- Chapter 786 - 0786: Ten Great Sects and a Nine-Headed Python May 21, 2026
- Chapter 785 - 0785: Bewitching Encounters in the Demon Realm May 21, 2026
- Chapter 784 - 0784: Navigating the Devilish Intricacies! May 21, 2026
- Chapter 783 - 0783: Outsmarting Devil Elders at the Demon an May 21, 2026
- Chapter 782 - 0782: Leading the Devil Elders to Their Demise May 21, 2026
- Chapter 781 - 0781: Unveiling the Secrets of the Devil Race’ May 21, 2026
- Chapter 780 - 0780: Unveiling the Power of the Demonic Blood May 21, 2026
- Chapter 779 - 0779: Unleashing the Power of Magical Corrupti May 21, 2026
- Chapter 778 - 0778: One-Man Assault on Great Devil Mountains May 21, 2026
- Chapter 777 - 0777: Demons Face Wrath After Poisonous Ambush May 21, 2026
- Chapter 776 - 0776: Demon Eyes Defeated, Devil-suppressing F May 21, 2026
- Chapter 775 - 0775: Chen Xiang’s Challenge Against the Demon May 21, 2026
- Chapter 774 - 0774: Demon and Devil Realms’ Challenge Unveil May 21, 2026
- Chapter 773 - 0773: The Demon and Devil Realms’ Ultimatum May 21, 2026
- Chapter 772 - 0772: The Warning from Ancient Spirit Great La May 21, 2026
- Chapter 771 - 0771: The Creation of Profound Realm Arrays May 21, 2026
- Chapter 770 - 0770: Unveiling the Strengths of the Demon Wor May 21, 2026
- Chapter 769 - 0769: Battle with Devil Cultivators in the Dem May 21, 2026
- Chapter 768 - 0768: The Ancient Spirit Great Land and the Un May 21, 2026
- Chapter 767 - 0767: Chen Xiang’s Encounter in Ancient Spirit May 21, 2026
- Chapter 766 - 0766: Confrontation with Thunder Heaven School May 21, 2026
- Chapter 765 - 0765: Confrontation with the Evil Barbarian May 21, 2026
- Chapter 764 - 0764: The Exiled Vile Race in Ancient Spirit G May 21, 2026
- Chapter 763 - 0763: Power Play and Friendship May 21, 2026
- Chapter 762 - 0762: Rescue of Teng Ying May 21, 2026
- Chapter 761 - 0761: The Enigmatic Fate of the Kylin Thunder May 21, 2026
- Chapter 760 - 0760: Ancient Spirit Great Land Expedition May 21, 2026
- Chapter 759 - 0759: Encounter in the Abyss and Divine Weapon May 21, 2026
- Chapter 758 - 0758: Heated Training and the Gateway to the P May 21, 2026
- Chapter 757 - 0757: Chen Xiang’s Training and the Ominous In May 21, 2026
- Chapter 756 - 0756: Rise of Peach Blossom Fairyland! May 21, 2026
- Chapter 755 - 0755: Dongfang Chaoqun’s Rise and Dongfang Lin May 21, 2026
- Chapter 754 - 0754: Passionate Training for Mental Fortitude May 21, 2026
- Chapter 753 - 0753: Hua Xiangyue’s Unique Method to Enhance May 21, 2026
- Chapter 752 - 0752: Elder Dan’s True Identity May 21, 2026
- Chapter 751 - 0751: Triple Peak-Quality Nine Quenching Body May 21, 2026
- Chapter 750 - 0750: Conquering the Mental Battle in the Illu May 21, 2026
- Chapter 749 - 0749: Illusions and Pill Refinement in the Pro May 21, 2026
- Chapter 748 - 0748: Concocting Pills Amidst Mental Turmoil May 21, 2026
- Chapter 747 - 0747: Into the Abyss of Confusion May 21, 2026
- Chapter 746 - 0746: Chen Xiang Faces a Mysterious Pill Refin May 21, 2026
- Chapter 745 - 0745: Quality Over Speed May 21, 2026
- Chapter 744 - 0744: Chen Xiang Challenges Dan Alliance Integ May 21, 2026
- Chapter 743 - 0743: Pill Refining Showdown May 21, 2026
- Chapter 742 - 0742: Schemes, Intrigues, and Unexpected Chall May 21, 2026
- Chapter 741 - 0741: Midst of Alchemy Excitement May 21, 2026
- Chapter 740 - 0740: Chen Xiang’s Pill Shop Ventures Begin May 21, 2026
- Chapter 739 - 0739: Close Encounter with Elder Dan May 21, 2026
- Chapter 738 - 0738: Turning the Tide Against Space Warcraft May 21, 2026
- Chapter 737 - 0737: Unmasking Deceit May 21, 2026
- Chapter 736 - 0736: Unmasking the Dongfang Family’s Deceit May 21, 2026
- Chapter 735 - 0735: Chen Xiang Faces the Dongfang Family’s Y May 21, 2026
- Chapter 734 - 0734: Chen Xiang Faces the Silver-Faced Assass May 21, 2026
- Chapter 733 - 0733: Chen Xiang’s Show of Power May 21, 2026
- Chapter 732 - 0732: Battle Amidst the Space Warcraft May 21, 2026
- Chapter 731 - 0731: A Master-Servant Contract Unveiled May 21, 2026
- Chapter 730 - 0730: The Fire Soul’s Salvation May 21, 2026
- Chapter 729 - 0729: The Array of Desires Unveiled May 21, 2026
- Chapter 728 - 0728: Illusions of Passion and the Hidden Arra May 21, 2026
- Chapter 727 - 0727: Unveiling the Mysterious Ice World May 21, 2026
- Chapter 726 - 0726: Facing the Angry Dragon Spirit May 21, 2026
- Chapter 725 - 0725: Dongfang Family’s Confrontation May 21, 2026
- Chapter 724 - 0724: Conflict in the Bloody Thunder Mountain May 21, 2026
- Chapter 723 - 0723: Thunder Clash in the Bloody Thunder Moun May 21, 2026
- Chapter 722 - 0722: A Journey to the Bloody Thunder Mountain May 21, 2026
- Chapter 721 - 0721: Unveiling Secrets and Crafting Power May 21, 2026
- Chapter 720 - 0720: Crafting with Beauties Under Fiery Eyes May 21, 2026
- Chapter 719 - 0719: Dongfang Xinyue’s Unexpected Rage May 21, 2026
- Chapter 718 - 0718: Chen Xiang Faces Huang Jintian’s Wrath May 21, 2026
- Chapter 717 - 0717: Chen Xiang’s Stand against the Dongfang May 21, 2026
- Chapter 716 - 0716: Retribution in the Eastern Profound Real May 21, 2026
- Chapter 715 - 0715: Unusual Day in the Eastern Profound Real May 21, 2026
- Chapter 714 - 0714: Unveiling Secrets in the Eastern Profoun May 21, 2026
- Chapter 713 - 0713: Unmasking the Chen Xiang Imposter May 21, 2026
- Chapter 712 - 0712: Chen Xiang’s Reputation at Stake May 21, 2026
- Chapter 711 - 0711: Dongfang Xinyue’s Intriguing Secrets May 21, 2026
- Chapter 710 - 0710: Chen Xiang Infiltrates the Dong Fang Cla May 21, 2026
- Chapter 709 - 0709: Exploring the Eastern Dynasty May 21, 2026
- Chapter 708 - 0708: Challenges and Surprises May 21, 2026
- Chapter 707 - 0707: Unraveling the Mystery of a Fractured Ci May 21, 2026
- Chapter 706 - 0706: Divine Purge: Confronting the Devil’s Sc May 21, 2026
- Chapter 705 - 0705: Ingenious Retribution May 21, 2026
- Chapter 704 - 0704: Divine Alchemy Showdown May 21, 2026
- Chapter 703 - 0703: Confrontation with the Poisonous Beast D May 21, 2026
- Chapter 702 - 0702: Unveiling Power May 21, 2026
- Chapter 701 - 0701: Divine Breakthrough May 21, 2026
- Chapter 700 - 0700: Struggle Against the Magical Corruption May 21, 2026
- Chapter 699 - 0699: Demonic Chaos Unleashed May 21, 2026
- Chapter 698 - 0698: Battle of the Realms May 21, 2026
- Chapter 697 - 0697: The Abyssal Confrontation: Chen Xiang’s May 21, 2026
- Chapter 696 - 0696: The Battle on the Demon God Altar May 21, 2026
- Chapter 695 - 0695: Unmasking the Devil’s Secrets May 21, 2026
- Chapter 694 - 0694: Infiltrating the Devil-subduing College May 21, 2026
- Chapter 693 - 0693: Leng Youlan’s Return and Unexpected Conv May 21, 2026
- Chapter 692 - 0692: Mortal Martial Realm’s Last Stand May 21, 2026
- Chapter 691 - 0691: Unveiling the Conspiracy: Tai Hong’s Dar May 21, 2026
- Chapter 690 - 0690: Thunderous Clash: Dragon Subduing vs Dev May 21, 2026
- Chapter 689 - 0689: Fierce Clash of Thunder and Devil Suppre May 21, 2026
- Chapter 688 - 0688: Flirtation in the Courtyard May 21, 2026
- Chapter 687 - 0687: Soul Extraction and the Furious Flame May 21, 2026
- Chapter 686 - 0686: Baptism by Fire and Water May 21, 2026
- Chapter 685 - 0685: Clash of Flames and Frost May 21, 2026
- Chapter 684 - 0684: Conspiracies Unveiled and Alliances Forg May 21, 2026
- Chapter 683 - 0683: Unveiling the Demonic Intrusion Conspira May 21, 2026
- Chapter 682 - 0682: Clash of Titans in the Demon Subduing Ma May 21, 2026
- Chapter 681 - 0681: The Demon’s Challenge May 21, 2026
- Chapter 680 - 0680: Group Competition Begins May 21, 2026
- Chapter 679 - 0679: A Modified Devil Subduing Method May 21, 2026
- Chapter 678 - 0678: Dilemma May 21, 2026
- Chapter 677 - 0677: Encounter with Ling Chong at Devil-subdu May 21, 2026
- Chapter 676 - 0676: Trade with Otherworldly Alchemists May 21, 2026
- Chapter 675 - 0675: Intervention in Dan Fragrance Pure Land May 21, 2026
- Chapter 674 - 0674: Standoff Against the God Child’s Wrath May 21, 2026
- Chapter 673 - 0673: Unyielding Stand Against the God Child’s May 21, 2026
- Chapter 672 - 0672: Chen Xiang Unleashes Dragon Power May 21, 2026
- Chapter 671 - 0671: Confrontation with the Sinister God Chil May 21, 2026
- Chapter 670 - 0670: The Destruction of Shao Yun Martial Club May 21, 2026
- Chapter 669 - 0669: The Hunt for Liao Shaoyun May 21, 2026
- Chapter 668 - 0668: Return to Shaoyun City May 21, 2026
- Chapter 667 - 0667: A Shattered Betrayal and a Resilient Ret May 21, 2026
- Chapter 666 - 0666: Unraveling Illusions, Summoning Stars, a May 21, 2026
- Chapter 665 - 0665: Unveiling Mysterious Origins and Fusing May 21, 2026
- Chapter 664 - 0664: A Night of Secrets and Bonds May 21, 2026
- Chapter 663 - 0663: A Priceless Offering May 21, 2026
- Chapter 662 - 0662: Unveiling Hidden Powers May 21, 2026
- Chapter 661 - 0661: Plan Unfolds May 21, 2026
- Chapter 660 - 0660: Encounter with Bai Xing May 21, 2026
- Chapter 659 - 0659: Pursuit of Chaos Fires May 21, 2026
- Chapter 658 - 0658: Intrigues in the Eighteenth Level May 21, 2026
- Chapter 657 - 0657: Breakthrough and Dragonic Revelation May 21, 2026
- Chapter 656 - 0656: The Awakening of Immortal Essence May 21, 2026
- Chapter 655 - 0655: Awakening the Fire Dragon May 21, 2026
- Chapter 654 - 0654: Unlocking the Secrets of the Fire God Dr May 21, 2026
- Chapter 653 - 0653: Chaos Fire’s Vengeance May 21, 2026
- Chapter 652 - 0652: Ambushed in the Tenth Floor City May 21, 2026
- Chapter 651 - 0651: The Chaotic Mountain Showdown May 21, 2026
- Chapter 650 - 0650: The Battle for the Chaos Fire May 21, 2026
- Chapter 649 - 0649: Unexpected Triumph and Du Hai’s Interven May 21, 2026
- Chapter 648 - 0648: Astonishing Success in Refining the Nine May 21, 2026
- Chapter 647 - 0647: Pinnacle Performance in the Pill Refinin May 21, 2026
- Chapter 646 - 0646: The Unconventional Showdown May 21, 2026
- Chapter 645 - 0645: Chen Xiang’s Unyielding Quest for Dinghu May 21, 2026
- Chapter 644 - 0644: Chen Xiang’s Triumph with Small Shaping May 21, 2026
- Chapter 643 - 0643: Chen Xiang’s Miraculous Performance and May 21, 2026
- Chapter 642 - 0642: Chaotic Mountain’s Vengeance and Chen Xi May 21, 2026
- Chapter 641 - 0641: The Allure of the Xie Sisters May 21, 2026
- Chapter 640 - 0640: Alchemy Showdown: Chen Xiang’s Challenge May 21, 2026
- Chapter 639 - 0639: Chen Xiang’s Mastery of Chaos Fire Unlea May 21, 2026
- Chapter 638 - 0638: Heavenly Refiner Chen Xiang May 21, 2026
- Chapter 637 - 0637: Chen Xiang’s Fiery Trials in the Sacred May 21, 2026
- Chapter 636 - 0636: Chen Xiang’s Journey through the Sacred May 21, 2026
- Chapter 635 - 0635: The Fiery Encounter May 21, 2026
- Chapter 634 - 0634: Whispers of Secrets May 21, 2026
- Chapter 633 - 0633: Chen Xiang’s Astonishing Offer at the Hi May 21, 2026
- Chapter 632 - 0632: Sacred Dan Realm’s Gathering May 21, 2026
- Chapter 631 - 0631: Divine Path Cultivation May 21, 2026
- Chapter 630 - 0630: A Shopping Spree and the Auction House D May 21, 2026
- Chapter 629 - 0629: Gift of Immortal Sword and Culinary Deli May 21, 2026
- Chapter 628 - 0628: Martial Arts Exchange and Chaotic Mounta May 21, 2026
- Chapter 627 - 0627: The Chaos Unveiled May 21, 2026
- Chapter 626 - 0626: Chen Xiang’s Battle with Guo Huaqing May 21, 2026
- Chapter 625 - 0625: Chaos Fire Token and Jade Dragon Flower May 21, 2026
- Chapter 624 - 0624: The Stolen Jade Dragon Flower May 21, 2026
- Chapter 623 - 0623: Chaos at the Sacred Dan Auction May 21, 2026
- Chapter 622 - 0622: Stealing the Jade Dragon Flower May 21, 2026
- Chapter 621 - 0621: Jade Dragon Flower’s Bloom May 21, 2026
- Chapter 620 - 0620: Bidding Frenzy for the White Flame Sky W May 21, 2026
- Chapter 619 - 0619: Provoking the Chaotic Flames May 21, 2026
- Chapter 618 - 0618: Fury Unleashed May 21, 2026
- Chapter 617 - 0617: Blue Flame Lion’s Provocation May 21, 2026
- Chapter 616 - 0616: Chen Xiang’s Farewell and the Hidden Tie May 21, 2026
- Chapter 615 - 0615: The Unveiling Power May 21, 2026
- Chapter 614 - 0614: Chen Xiang’s Ferocious Roar May 21, 2026
- Chapter 613 - 0613: Chen Xiang’s Extraordinary Breakthrough May 21, 2026
- Chapter 612 - 0612: Sonic Annihilation May 21, 2026
- Chapter 611 - 0611: Flames of Suppression May 21, 2026
- Chapter 610 - 0610: Chen Xiang’s Confrontation with Darkness May 21, 2026
- Chapter 609 - 0609: Inferno Showdown May 21, 2026
- Chapter 608 - 0608: Chen Xiang’s Trial in the Sacred Dan Mee May 21, 2026
- Chapter 607 - 0607: Unveiling Secrets May 21, 2026
- Chapter 606 - 0606: The Fiancé Plot May 21, 2026
- Chapter 605 - 0605: Alchemy Rivalry and Jealous Suitors May 21, 2026
- Chapter 604 - 0604: Devil-Suppressing Golden Body May 21, 2026
- Chapter 603 - 0603: Assimilating the Devil-Suppressing Blood May 21, 2026
- Chapter 602 - 0602: The Power of the Devil-Suppressing Mirro May 21, 2026
- Chapter 601 - 0601: Forbidden Dragon Punishment Unleashed May 21, 2026
- Chapter 600 - 0600: Divine Confrontation May 21, 2026
- Chapter 599 - 0599: Chasing the Dragon with Du Hai’s Plan May 21, 2026
- Chapter 598 - 0598: Chen Xiang’s Quest for Devil-Suppressing May 21, 2026
- Chapter 597 - 0597: Chasing the Legacy May 21, 2026
- Chapter 596 - 0596: Chasing the Whisper of the Devil-Suppres May 21, 2026
- Chapter 595 - 0595: The Quest for Devil-Suppressing Blood May 21, 2026
- Chapter 594 - 0594: Unraveling Secrets May 21, 2026
- Chapter 593 - 0593: Alchemy and Tangled Emotions May 21, 2026
- Chapter 592 - 0592: The Purple Dragon Flower’s Secret May 21, 2026
- Chapter 591 - 0591: Refining Pills in the Midst of Temptatio May 21, 2026
- Chapter 590 - 0590 : The Poisonous Betrayal in the Immortal- May 21, 2026
- Chapter 589 - 0589 : The Hunt for Purple Dragon Flower May 21, 2026
- Chapter 588 - 0588: A Clash of Strength and Noble Aura May 21, 2026
- Chapter 587 - 0587: Chen Xiang’s Challenge May 21, 2026
- Chapter 586 - 0586: Unleashing the Power of Devil-suppressin May 21, 2026
- Chapter 585 - 0585: Battle for Sacred Dan City May 21, 2026
- Chapter 584 - 0584: Alchemist Evaluation and the Mayor of Sa May 21, 2026
- Chapter 583 - 0583: Sacred Dan City and Alchemist Assessment May 21, 2026
- Chapter 582 - 0582: Arrival in Sacred Dan Realm May 21, 2026
- Chapter 581 - 0581: Journey to the Sacred Dan Realm May 21, 2026
- Chapter 580 - 0580: Alchemy Triumph: The Unseen Artistry of May 21, 2026
- Chapter 579 - 0579: Alchemy Duel: Battle of the Burning Furn May 21, 2026
- Chapter 578 - 0578: Foreseeing Alchemy Mastery: Chen Xiang’s May 21, 2026
- Chapter 577 - 0577: Hua Qiuxia’s Demand and Chen Xiang’s Def May 21, 2026
- Chapter 576 - 0576: Preparing for the Great War Between Thre May 21, 2026
- Chapter 575 - 0575: Heavenly Gift May 21, 2026
- Chapter 574 - 0574: Sacred Dan Realm’s Challenge May 21, 2026
- Chapter 573 - 0573: Unveiling Devil-Suppressing Fist’s Profo May 21, 2026
- Chapter 572 - 0572: Digging for Riches: Harvesting the Diamo May 21, 2026
- Chapter 571 - 0571: Two Conditions and a Sinister Bargain May 21, 2026
- Chapter 570 - 0570: The Unexpected Benefits of Eight-Armed G May 21, 2026
- Chapter 569 - 0569: Uncovering the Devil-subduing College’s May 21, 2026
- Chapter 568 - 0568: The Terrifying Power Behind the Scenes May 21, 2026
- Chapter 567 - 0567: Assassination Attempt: May 21, 2026
- Chapter 566 - 0566: Hidden Agendas May 21, 2026
- Chapter 565 - 0565: Return to Icy Wind Valley: Chen Xiang’s May 21, 2026
- Chapter 564 - 0564: Jealousy and Confrontation: Hundred Flow May 21, 2026
- Chapter 563 - 0563: Breaking Boundaries May 21, 2026
- Chapter 562 - 0562: Divine Retribution May 21, 2026
- Chapter 561 - 0561: Flames Quenched by Dragons May 21, 2026
- Chapter 560 - 0560: The Month of Hell for Chen Xiang May 21, 2026
- Chapter 559 - 0559: Nature’s Price for Freedom May 21, 2026
- Chapter 558 - 0558: Unveiling Secrets and Power Struggles May 21, 2026
- Chapter 557 - 0557: Thunderous Revelation May 21, 2026
- Chapter 556 - 0556: Sibling Reunion: A Joyous Encounter May 21, 2026
- Chapter 555 - 0555: The Enigmatic Fire Dragon Martial Spirit May 21, 2026
- Chapter 554 - 0554: The Soul Martial Realm Challenge May 21, 2026
- Chapter 553 - 0553: Trial by Fire May 21, 2026
- Chapter 552 - 0552: Sensual Alchemy Unveiled May 21, 2026
- Chapter 551 - 0551: Passion in the Forbidden Bath May 21, 2026
- Chapter 550 - 0550: "The Forbidden Alchemy: Concocting the G May 21, 2026
- Chapter 549 - 0549: Heavenly Thunder Pill May 21, 2026
- Chapter 548 - 0548: Stellar Transposition Realm May 21, 2026
- Chapter 547 - 0547: Returning to the Magic Academy May 21, 2026
- Chapter 546 - 0546: Sacred Dan Realm May 21, 2026
- Chapter 545 - 0545: Transformative Demonic Beast May 21, 2026
- Chapter 544 - 0544: Fall of the Strong May 21, 2026
- Chapter 543 - 0543: Carnage May 21, 2026
- Chapter 542 - 0542: Heaven Mending Stone May 21, 2026
- Chapter 541 - 0541: Raging Inferno Dantian May 21, 2026
- Chapter 540 - 0540: Legends of Mysterious Dan May 21, 2026
- Chapter 539 - 0539: Treasure Under The Lake May 21, 2026
- Chapter 538 - 0538: Fire God Law May 21, 2026
- Chapter 537 - 0537: Benefit From A Conflict May 21, 2026
- Chapter 536 - 0536: Stele May 21, 2026
- Chapter 535 - 0535: Faerie Goods May 21, 2026
- Chapter 534 - 0534: Reversion May 21, 2026
- Chapter 533 - 0533: Black-Stone Dragon May 21, 2026
- Chapter 532 - 0532: The Sun Moon Island May 21, 2026
- Chapter 531 - 0531 - Supreme Treasure Profound Realm May 21, 2026
- Chapter 530 - 0530: Eclipse May 21, 2026
- Chapter 529 - 0529 Visitors From the Heavenly Realm May 21, 2026
- Chapter 528 - 0528: First Attempt of Spirit Travel May 21, 2026
- Chapter 527 - 0527 A Naive White-Haired Beauty May 21, 2026
- Chapter 526 - 0526 – Love in a Cave May 21, 2026
- Chapter 525 - 0525 – Seizing the Soul (Part Two) May 21, 2026
- Chapter 524 - 0524 – Seizing the Soul (Part One) May 21, 2026
- Chapter 523 - 0523 – The Power of Dragon Force May 21, 2026
- Chapter 522 - 0522 – Romance in a Bath May 21, 2026
- Chapter 521 - 0521 – Zuo Zhenxuan May 21, 2026
- Chapter 520 - 0520 – A Fortuitous Encounter in the Dungeon May 21, 2026
- Chapter 519 - 0519 – Frightening the Whole Field May 21, 2026
- Chapter 518 - 0518 – Arrogant Words May 21, 2026
- Chapter 517 - 0517 – Completely Enraged May 21, 2026
- Chapter 516 - 0516 – A Comprehensive Preparation May 21, 2026
- Chapter 515 - 0515 – The Tenth Level of Demon Subduing Force May 21, 2026
- Chapter 514 - 0514 – Oath in the Heart May 21, 2026
- Chapter 513 - 0513 – A Brutal Young Man May 21, 2026
- Chapter 512 - 0512 – A Fierce Encounter May 21, 2026
- Chapter 511 - 0511 – An Arrogant Person May 21, 2026
- Chapter 510 - 0510 - Demon Subduing Force May 21, 2026
- Chapter 509 - 0509 - Life in the Academy May 21, 2026
- Chapter 508 - 0508 - The Girl Got Defeated May 21, 2026
- Chapter 507 - 0507 - A Match Between the Brother and Sister May 21, 2026
- Chapter 506 - 0506 - Demon Subduing Stones May 21, 2026
- Chapter 505 - 0505 - A Romance on the Bed May 21, 2026
- Chapter 504 - 0504 - Thoughts of Women May 21, 2026
- Chapter 503 - 0503 - The Majesty of Xianxian May 21, 2026
- Chapter 502 - 0502 - The Fairy Has Grown Up May 21, 2026
- Chapter 501 - 0501 - Challenge of a Female Overlord May 21, 2026
- Chapter 500 - 0500: The Shock of Purgatory May 21, 2026
- Chapter 499 - 0499 – Bloody Saber-Teethed Tiger May 21, 2026
- Chapter 498 - 0498 – Demon Subduing Academy May 21, 2026
- Chapter 497 - 0497 – Assistance From Outside the Heaven May 21, 2026
- Chapter 496 - 0496 The Pure Essence Golden Dan May 21, 2026
- Chapter 495 - 0495 The Power of Creation (Part II) May 21, 2026
- Chapter 494 - 0494 The Power of Creation (Part I) May 21, 2026
- Chapter 493 - 0493 A Sore Secret May 21, 2026
- Chapter 492 - 0492 Hand of Slaughter of God May 21, 2026
- Chapter 491 - 0491 - The Incomparable Charm of the Lady Empe May 21, 2026
- Chapter 490 - 0490 - Counterattack May 21, 2026
- Chapter 489 - 0489 - A Crisis Before the Divine Weapon May 21, 2026
- Chapter 488 - 0488 - The Star and Moon Berserk Dragon May 21, 2026
- Chapter 487 - 0487 - Thorough Suppression May 21, 2026
- Chapter 486 - 0486 - You’re Still Too Young May 21, 2026
- Chapter 485 - 0485 - The God of Slaughter May 21, 2026
- Chapter 484 - 0484 – Prophet of the White Tiger Battle Clan May 21, 2026
- Chapter 483 - 0483 – The White Tiger Battle Clan May 21, 2026
- Chapter 482 - 0482 – A Land with Ice and Snow May 21, 2026
- Chapter 481 - 0481 – Death Storm May 21, 2026
- Chapter 480 - 0480 – The Profound Realm Opened May 21, 2026
- Chapter 479 - 0479 – Falling Out May 21, 2026
- Chapter 478 - 0478 – The Rival of Flame May 21, 2026
- Chapter 477 - 0477 – Combat May 21, 2026
- Chapter 476 - 0476 – An Arrogant Provocation May 21, 2026
- Chapter 475 - 0475 – The Heaven-Earth Fire May 21, 2026
- Chapter 474 - 0474 – Ambush by Heart Penetrating Demon Eyes May 21, 2026
- Chapter 473 - 0473 – The Heaven-Earth Fire Soul May 21, 2026
- Chapter 472 - 0472 – The Earth Fire Soul May 21, 2026
- Chapter 471 - 0471 – Earth’s Core May 21, 2026
- Chapter 470 - 0470 – Guidance of the Divine Weapon May 21, 2026
- Chapter 469 - 0469 – Making a Hard Decision May 21, 2026
- Chapter 468 - 0468 – Fighting Below the Sea May 21, 2026
- Chapter 467 - 0467 – Mysterious Whirlpool May 21, 2026
- Chapter 466 - 0466 – Fire God Shrine May 21, 2026
- Chapter 465 - 0465 – Searching for Divine Weapon May 21, 2026
- Chapter 464 - 0464 – Master-Slave Contract May 21, 2026
- Chapter 463 - 0463 – Danxiang Taoyuan May 21, 2026
- Chapter 462 - 0462 – Still a Long Way to Go May 21, 2026
- Chapter 461 - 0461 – Tensed Situation May 21, 2026
- Chapter 460 - 0460 – Sincerely Convinced May 21, 2026
- Chapter 459 - 0459 – New Challenge May 21, 2026
- Chapter 458 - 0458 – Baptizing Bone Dan May 21, 2026
- Chapter 457 - 0457 – A Shocking Difference May 21, 2026
- Chapter 456 - 0456 – Young vs Old May 21, 2026
- Chapter 455 - 0455 – Dan King’s Apprentice May 21, 2026
- Chapter 454 - 0454 – Dragon May 21, 2026
- Chapter 453 - 0453 – Ruins May 21, 2026
- Chapter 452 - 0452 – Sacred Ancient Land May 21, 2026
- Chapter 451 - 0451 – Pure Bliss Amidst Peril May 21, 2026
- Chapter 450 - 0450 – The Blood Lightning Demi-Human May 21, 2026
- Chapter 449 - 0449 – Blood Lightning Mountain Sea May 21, 2026
- Chapter 448 - 0448 – Slave? May 21, 2026
- Chapter 447 - 0447- Returning to the Kings’ Mainland May 21, 2026
- Chapter 446 - 0446 – Kissing the Goddesses May 21, 2026
- Chapter 445 - 0445 – Elder Dan’s Decision May 21, 2026
- Chapter 444 - 0444 – A Huge Reward May 21, 2026
- Chapter 443 - 0443 – King’s Palace May 21, 2026
- Chapter 442 - 0442 – King’s Mysterious Realm May 21, 2026
- Chapter 441 - 0441 – Heavenly Dragon Subduing the Devil May 21, 2026
- Chapter 440 - 0440 – Devil Lord’s Resurrection May 21, 2026
- Chapter 439 - 439 – Fight With a Devil May 21, 2026
- Chapter 438 - 438 – Devil Lord Evil Skeleton May 21, 2026
- Chapter 437 - 0437 – EVIL SKELETON MARTIAL SOUL May 21, 2026
- Chapter 436 - 0436 – DEATH HAND May 21, 2026
- Chapter 435 - 0435 – The Fearsome Martial Soul May 21, 2026
- Chapter 434 - 0434 – Devil Eye May 21, 2026
- Chapter 433 - 0433 – Mysterious Rewards May 21, 2026
- Chapter 432 - 0432 – The Strongest Four May 21, 2026
- Chapter 431 - 0431 – The Results of the Competition (II) May 21, 2026
- Chapter 430 - 0430 – THE RESULT OF THE COMPETITION (I) May 21, 2026
- Chapter 429 - 0429 – Chance Encounter With Lanlan May 21, 2026
- Chapter 428 - 0428 – Furious Smile May 21, 2026
- Chapter 427 - 0427 – The Battle Inside the Canyon May 21, 2026
- Chapter 426 - 0426 - The Last Fervour May 21, 2026
- Chapter 425 - 0425 - The Poisonous Scorpion King May 21, 2026
- Chapter 424 - 0424 - A Beautiful Trap May 21, 2026
- Chapter 423 - 0423 - Black Wood Canyon May 21, 2026
- Chapter 422 - 0422 - The Might of Devil Skills May 21, 2026
- Chapter 421 - 0421 - Suppressing Devil Treasure Mirror May 21, 2026
- Chapter 420 - 0420 - Skillfully Taking Demon Cores May 21, 2026
- Chapter 419 - 0419 - Wolf Slave May 21, 2026
- Chapter 418 - 0418 - Suppressing Devil Yuan Qi May 21, 2026
- Chapter 417 - 0417 - Evil Demon Mysterious Realm May 21, 2026
- Chapter 416 - 0416 - Big Gift May 21, 2026
- Chapter 415 - 0415 - Endpoint May 21, 2026
- Chapter 414 - 0414 - Confrontation in the night May 21, 2026
- Chapter 413 - 0413 - Grasping Soul Talisman May 21, 2026
- Chapter 412 - 0412 - Unending Obstacles May 21, 2026
- Chapter 411 - 0411 - Inferno in the sky May 21, 2026
- Chapter 410 - 0410 - Fire Lightning Wings May 21, 2026
- Chapter 409 - 0409 - Blue Blood Clan May 21, 2026
- Chapter 408 - 0408 - Golden Lion Eagle May 21, 2026
- Chapter 407 - 0407 - Good Appetite May 21, 2026
- Chapter 406 - 0406 - Strongest Power May 21, 2026
- Chapter 405 - 0405 - Dark Power May 21, 2026
- Chapter 404 - 0404 - Qiu Sheng May 21, 2026
- Chapter 403 - 0403 - Continuous Challenges May 21, 2026
- Chapter 402 - 0402 - WATER RESTRICTS FIRE May 21, 2026
- Chapter 401 - 0401 - Important Match May 21, 2026
- Chapter 400 - 0400 - Three Days May 21, 2026
- Chapter 399 - 0399 - Frightening The Kings May 21, 2026
- Chapter 398 - 0398 - Power in Ebullition May 21, 2026
- Chapter 397 - 0397 - Extreme State May 21, 2026
- Chapter 396 - 0396 - Bestowal Of Power May 21, 2026
- Chapter 395 - 0395 - Huang Jintian’S Programme May 21, 2026
- Chapter 394 - 0394 - Small Victory May 21, 2026
- Chapter 393 - 0393 - Dual Tasking May 21, 2026
- Chapter 392 - 0392 - Astonishing Unique Technique May 21, 2026
- Chapter 391 - 0391 - The Scheme Of Kings’ Mainland May 21, 2026
- Chapter 390 - 0390 - Fruit Of Fortune May 21, 2026
- Chapter 389 - 0389 - Embarking Upon The King’S Soil May 21, 2026
- Chapter 388 - 0388 - Powerful Veins May 21, 2026
- Chapter 387 - 0387 - Kings’ Martial Art Meet May 21, 2026
- Chapter 386 - 0386 - Training Plan May 21, 2026
- Chapter 385 - 0385 - Sweet After Sweat May 21, 2026
- Chapter 384 - 0384 - King’S Descendant May 21, 2026
- Chapter 383 - 0383 - Temporarily Not Going May 21, 2026
- Chapter 382 - 0382 - Deep Sea Treasure May 21, 2026
- Chapter 381 - 0381 - Seaside May 21, 2026
- Chapter 380 - 0380 - Luo Tian Door May 21, 2026
- Chapter 379 - 0379 - Inheritance May 21, 2026
- Chapter 378 - 0378 - kings’ mainland May 21, 2026
- Chapter 377 - 0377 - Fortuitous Encounter May 21, 2026
- Chapter 376 - 0376 - Mysterious Passage May 21, 2026
- Chapter 375 - 0375 - Shocking Development May 21, 2026
- Chapter 374 - 0374 - Creating Opportunity May 21, 2026
- Chapter 373 - 0373 - Impossible to Escape May 21, 2026
- Chapter 372 - 0372 - The Most Crucial Character May 21, 2026
- Chapter 371 - 0371 - Law May 21, 2026
- Chapter 370 - 0370 - Ambition May 21, 2026
- Chapter 369 - 0369 - Taking a Stand May 21, 2026
- Chapter 368 - 0368 - The Hero Mountain May 21, 2026
- Chapter 367 - 0367 - Imminent Crisis May 21, 2026
- Chapter 366 - 0366 - Unstable Situation May 21, 2026
- Chapter 365 - 0365 - The Sacred Light Temple Pope May 21, 2026
- Chapter 364 - 0364 - Blood For Blood May 21, 2026
- Chapter 363 - 0363 - Sacred Light Temple May 21, 2026
- Chapter 362 - 0362 - Master and Disciples Together May 21, 2026
- Chapter 361 - 0361 - Public Indignation May 21, 2026
- Chapter 360 - 0360 - The Will of Martial Arts Way May 21, 2026
- Chapter 359 - 0359 - Isolated May 21, 2026
- Chapter 358 - 0358 - Peace Talks May 21, 2026
- Chapter 357 - 0357 - Thunderbolt Strike May 21, 2026
- Chapter 356 - 0356 - Awakening of Strength May 21, 2026
- Chapter 355 - 0355 - Fight Again With Xiao Chou (Final Part) May 21, 2026
- Chapter 354 - 0354 - Fight Again With Xiao Chou (First Part) May 21, 2026
- Chapter 353 - 0353 - Dragon Force May 21, 2026
- Chapter 352 - 0352 - Letter of Challenge May 21, 2026
- Chapter 351 - 0351 - Reclusive Alchemy Training (Final Part) May 21, 2026
- Chapter 350 - 0350 - Reclusive Alchemy Training May 21, 2026
- Chapter 349 - 0349 - Harvest May 21, 2026
- Chapter 348 - 0348 - Get Together May 21, 2026
- Chapter 347 - 0347 - Gathering of Experts May 21, 2026
- Chapter 346 - 0346 - A Rare Smile May 21, 2026
- Chapter 345 - 0345 - Invulnerable to Poison May 21, 2026
- Chapter 344 - 0344 - Devil Scorpion Princess May 21, 2026
- Chapter 343 - 0343 - Scorpion-like Woman May 21, 2026
- Chapter 342 - 0342 - The Suppressing Devil Golden Body May 21, 2026
- Chapter 341 - 0341 - Double Headed Snake Demon May 21, 2026
- Chapter 340 - 0340 - The Army Of Demon And Devil May 21, 2026
- Chapter 339 - 0339 - Step Into The Devil Mountain May 21, 2026
- Chapter 338 - 0338 - The Catastrophes Mouth May 21, 2026
- Chapter 337 - 0337 - Hopeful Nirvana May 21, 2026
- Chapter 336 - 0336 - The One Hundred Thousand Devil Mountain May 21, 2026
- Chapter 335 - 0335 - The Suppressing Devil Divine Exercise May 21, 2026
- Chapter 334 - 0334 - Foretell May 21, 2026
- Chapter 333 - 0333 - Re-Entering The Forbidden Land May 21, 2026
- Chapter 332 - 0332 - The Ten Thousand Years Old Spirit Milk May 21, 2026
- Chapter 331 - 0331 - The Furious Dragons Retribution May 21, 2026
- Chapter 330 - 0330 - The Dragoness’ Prowess May 21, 2026
- Chapter 329 - 0329 - Ice Spirit Devil Aura May 21, 2026
- Chapter 328 - 0328 - Formidable Adversary May 21, 2026
- Chapter 327 - 0327 - The Herculean Clan (Final Part) May 21, 2026
- Chapter 326 - 0326 - The Herculean Clan (First Part) May 21, 2026
- Chapter 325 - 0325 - Merciless May 21, 2026
- Chapter 324 - 0324 - Beautiful Plan May 21, 2026
- Chapter 323 - 0323 - Showing Mercy May 21, 2026
- Chapter 322 - 0322 - The Golden Sheathed Swordsman May 21, 2026
- Chapter 321 - 0321 - The Danxiang Taoyuans Dean May 21, 2026
- Chapter 320 - 0320 - Disdaining the World May 21, 2026
- Chapter 319 - 0319 - Xiao Ziliang May 21, 2026
- Chapter 318 - 0318 - The Magical Effect Of Mana May 21, 2026
- Chapter 317 - 0317 - Challenging The Limit May 21, 2026
- Chapter 316 - 0316 - Potential May 21, 2026
- Chapter 315 - 0315 - A Step Further May 21, 2026
- Chapter 314 - 0314 - Learning And Applying At Hand May 21, 2026
- Chapter 313 - 0313 - Refining Simulation Technique May 21, 2026
- Chapter 312 - 0312 - Brilliant May 21, 2026
- Chapter 311 - 0311 - The Illusionary Brilliant Furnace May 21, 2026
- Chapter 310 - 0310 - Lost? May 21, 2026
- Chapter 309 - 0309 - Creating Miracles May 21, 2026
- Chapter 308 - 0308 - Bad Luck May 21, 2026
- Chapter 307 - 0307 - Peerless Genius May 21, 2026
- Chapter 306 - 306 - Second Round May 21, 2026
- Chapter 305 - 0305 - Perfect Clearance May 21, 2026
- Chapter 304 - 0304 - Flame Tournament May 21, 2026
- Chapter 303 - 0303 - Ten Thousand Years Spirit Milk May 21, 2026
- Chapter 302 - 0302 - The Shocking Physique May 21, 2026
- Chapter 301 - 0301 - Fire Dragon Blood Lotus May 21, 2026
- Chapter 300 - 0300 - Lian Yingxiao May 21, 2026
- Chapter 299 - 0299 - Complete Divine Blade May 21, 2026
- Chapter 298 - 0298 - Dragon Soul (Part-2) May 21, 2026
- Chapter 297 - 0297 - Dragon Soul (Part-1) May 21, 2026
- Chapter 296 - 0296 - Resurrection Grass May 21, 2026
- Chapter 295 - 0295 - The Contention Of Fire Martial Soul May 21, 2026
- Chapter 294 - 0294 - Making A Killing May 21, 2026
- Chapter 293 - 0293 - Good Play Staged May 21, 2026
- Chapter 292 - 0292 - The Stingy Dean May 21, 2026
- Chapter 291 - 0291 - Fire Martial Soul May 21, 2026
- Chapter 290 - 0290 - Yue Jianglin May 21, 2026
- Chapter 289 - 0289 - 5th Level Alchemist May 21, 2026
- Chapter 288 - 0288 - Successful May 21, 2026
- Chapter 287 - 0287 - Zhenzhen May 21, 2026
- Chapter 286 - 0286 - Diligently Refining May 21, 2026
- Chapter 285 - 0285 - 5th Level Assessment May 21, 2026
- Chapter 284 - 0284 - Reining In May 21, 2026
- Chapter 283 - 0283 - Tiger Fist Vs White Tiger May 21, 2026
- Chapter 282 - 0282 - White Tiger Family May 21, 2026
- Chapter 281 - 0281 - Capturing The Beast May 21, 2026
- Chapter 280 - 0280 - Hundred Beasts Dan May 21, 2026
- Chapter 279 - 0279 - Cheering Up May 21, 2026
- Chapter 278 - 0278 - Disappeared Mainland May 21, 2026
- Chapter 277 - 0277 - Hundred Beasts Dan May 21, 2026
- Chapter 276 - 0276 - High Rank Tournament May 21, 2026
- Chapter 275 - 0275 - Divine Weapon’s Trail May 21, 2026
- Chapter 274 - 0274 - Kissing May 21, 2026
- Chapter 273 - 0273 - Agonizing May 21, 2026
- Chapter 272 - 0272 - Fire Spirit’s Reappearance May 21, 2026
- Chapter 271 - 0271 - Taoyuan Grand Meeting May 21, 2026
- Chapter 270 - 0270 - Tyrannical May 21, 2026
- Chapter 269 - 0269 - Amazing Progress May 21, 2026
- Chapter 268 - 0268 - 5th Level Immortal And Devil Body May 21, 2026
- Chapter 267 - 267 - White Jade Dragon Cauldron May 21, 2026
- Chapter 266 - 0266 - Jealousy May 21, 2026
- Chapter 265 - 0265 - Refine Me May 21, 2026
- Chapter 264 - 0264 - Black Tortoise External Strength Techni May 21, 2026
- Chapter 263 - 0263 - Ghost Martial Technique May 21, 2026
- Chapter 262 - 0262 - The Missing Genius May 21, 2026
- Chapter 261 - 0261 - White Jade Lotus Seed May 21, 2026
- Chapter 260 - 0260 - Rewards of the Tycoons May 21, 2026
- Chapter 259 - 0259 - Perishing Golden Body May 21, 2026
- Chapter 258 - 0258 - Forgone Conclusion May 21, 2026
- Chapter 257 - 0257 - Devil Elemental Nuclei May 21, 2026
- Chapter 256 - 0256 - Heart Rending Strike May 21, 2026
- Chapter 255 - 0255 - Powerful Devil Beast May 21, 2026
- Chapter 254 - 0254 - Devil God’s Command May 21, 2026
- Chapter 253 - 0253 - Destruction Of The Altar May 21, 2026
- Chapter 252 - 0252 - Devil Soul May 21, 2026
- Chapter 251 - 0251 - Penetrating Heart Devil Eye May 21, 2026
- Chapter 250 - 0250 - Averting Crisis May 21, 2026
- Chapter 249 - 0249 - Priest May 21, 2026
- Chapter 248 - 0248 - Greater Crisis May 21, 2026
- Chapter 247 - 0247 - Profound Fire Exquisite Tower May 21, 2026
- Chapter 246 - 0246 - Working Together May 21, 2026
- Chapter 245 - 0245- Finally Gathered May 21, 2026
- Chapter 244 - 0244 - Wei Hongtao May 21, 2026
- Chapter 243 - 0243 - Red Wolves May 21, 2026
- Chapter 242 - 0242 - Nine Turn Dragon God Technique May 21, 2026
- Chapter 241 - 0241 - Great Swallowing May 21, 2026
- Chapter 240 - 0240 - Turning Back On Old Acquaintances May 21, 2026
- Chapter 239 - 0239 - Devil Beast Raid May 21, 2026
- Chapter 238 - 0238 - Counterattack In The Wasteland (Part 2) May 21, 2026
- Chapter 237 - 0237 - Counterattack In The Wasteland (Part 1) May 21, 2026
- Chapter 236 - 0236 - Dangerous Encounter May 21, 2026
- Chapter 235 - 0235 - Devil Palm’s Might May 21, 2026
- Chapter 234 - 0234 - Human Devil May 21, 2026
- Chapter 233 - 0233 - Puppet May 21, 2026
- Chapter 232 - 0232 - All By Himself May 21, 2026
- Chapter 231 - 0231 - Gather May 21, 2026
- Chapter 230 - 0230 - Fire Spirit Fusion May 21, 2026
- Chapter 229 - 0229 - Feeling Proud And Elated May 21, 2026
- Chapter 228 - 0228 - Heavenly Dragon Seal May 21, 2026
- Chapter 227 - 0227 - Transformation Technique May 21, 2026
- Chapter 226 - 0226 - Devil Path Plan May 21, 2026
- Chapter 225 - 0225 - Shinto May 21, 2026
- Chapter 224 - 0224 - Buying Popularity May 21, 2026
- Chapter 223 - 0223 - Candidates May 21, 2026
- Chapter 222 - 0222 - You Bet, You Pay May 21, 2026
- Chapter 221 - 0221 - Can’t Lose May 21, 2026
- Chapter 220 - 0220 - Elemental Spirit Dan May 21, 2026
- Chapter 219 - 0219 - World First Mysterious Realm May 21, 2026
- Chapter 218 - 0218 - Cleaned Out Everything May 21, 2026
- Chapter 217 - 0217 - Herb King Mountain May 21, 2026
- Chapter 216 - 0216 - Four Devil Techniques May 21, 2026
- Chapter 215 - 0215 - Act First, Report Later May 21, 2026
- Chapter 214 - 0214 - Ungrateful May 21, 2026
- Chapter 213 - 0213 - The Divine Weapon Sect And The Icewind May 21, 2026
- Chapter 212 - 0212 - Lu Family’s Secret May 21, 2026
- Chapter 211 - 0211 - Emperor Crystal May 21, 2026
- Chapter 210 - 0210 - White Dragon blood May 21, 2026
- Chapter 209 - 0209 - Identity Exposed May 21, 2026
- Chapter 208 - 0208 - Proud Sword Sect May 21, 2026
- Chapter 207 - 0207 - Siblings Team Up May 21, 2026
- Chapter 206 - 0206 - Devil Bow Might May 21, 2026
- Chapter 205 - 0205 - Great Storm May 21, 2026
- Chapter 204 - 0204 - Unexpected Encounter May 21, 2026
- Chapter 203 - 0203 - Beating In Their Own Game May 21, 2026
- Chapter 202 - 0202 - Divine Sword Province May 21, 2026
- Chapter 201 - 0201 - Lu Family’s Secret May 21, 2026
- Chapter 200 - 0200 - New Extreme Martial Sect May 21, 2026
- Chapter 199 - 0199 - Inducements May 21, 2026
- Chapter 198 - 0198 - A Man’s Heart Is Incomprehensible May 21, 2026
- Chapter 197 - 0197 - Boosted Reputation May 21, 2026
- Chapter 196 - 0196 - Thunderbolt Cut May 21, 2026
- Chapter 195 - 0195 - Duel May 21, 2026
- Chapter 194 - 0194 - Evil Dragon Martial Technique May 21, 2026
- Chapter 193 - 0193 - Betting Head May 21, 2026
- Chapter 192 - 0192 - Golden Dragon Saliva (Part 2) May 21, 2026
- Chapter 191 - 0191 - Golden Dragon Saliva (Part 1) May 21, 2026
- Chapter 190 - 0190 - Fire Spirit’s Crisis May 21, 2026
- Chapter 189 - 0189 - An Astonishing Speed May 21, 2026
- Chapter 188 - 0188 - Wild Ambitions May 21, 2026
- Chapter 187 - 0187 - Slaughter Qi May 21, 2026
- Chapter 186 - 0186 - Turbulent Times May 21, 2026
- Chapter 185 - 0185 - Five Elements Profound Dan May 21, 2026
- Chapter 184 - 0184 - Earth Core Divine Fruit May 21, 2026
- Chapter 183 - 0183 - Past Of The Fire Beast May 21, 2026
- Chapter 182 - 0182 - Heavenly Sun Fire Spirit May 21, 2026
- Chapter 181 - 0181 - Ancient Fire Beast May 21, 2026
- Chapter 180 - 0180 - The Mysterious Beast Roar May 21, 2026
- Chapter 179 - 0179 - The Netherworld Abyss May 21, 2026
- Chapter 178 - 0178 - Betrayal May 21, 2026
- Chapter 177 - 0177 - The Martial Uncle’s Ferocity May 21, 2026
- Chapter 176 - 0176 - Recreating History May 21, 2026
- Chapter 175 - 0175 - Dominating The Mysterious Realm May 21, 2026
- Chapter 174 - 0174 - Destroy May 21, 2026
- Chapter 173 - 0173 - The Fertile Island May 21, 2026
- Chapter 172 - 0172 - The Vermillion Bird’s Tender Thread May 21, 2026
- Chapter 171 - 0171 - Sleeping Divine Weapon May 21, 2026
- Chapter 170 - 0170 - The Vermilion Bird Divine Weapon May 21, 2026
- Chapter 169 - 0169 - Divine Armor’s Owner May 21, 2026
- Chapter 168 - 0168 - Adamantyl Crocodile Python May 21, 2026
- Chapter 167 - 0167 – Realm Within Realm May 21, 2026
- Chapter 166 - 0166 - Water Way May 21, 2026
- Chapter 165 - 0165 - Heavenly Dark Mouse May 21, 2026
- Chapter 164 - 0164 - Otherworldly Civilization May 21, 2026
- Chapter 163 - 0163 - Enchantment Of Spirit Veins May 21, 2026
- Chapter 162 - 0162 - Black Tortoise Mysterious Realm May 21, 2026
- Chapter 161 - 0161 - Awakening of Divine Armor May 21, 2026
- Chapter 160 - 0160 – Might Of Divine Blade May 21, 2026
- Chapter 159 - 0159 – Foot Of The Black Tortoise Mountain May 21, 2026
- Chapter 158 - 0158 – Empress Tenderness May 21, 2026
- Chapter 157 - 0157 – Reunion May 21, 2026
- Chapter 156 - 0156 – Man Eating Griffin May 21, 2026
- Chapter 155 - 0155 – Gambling Debt Crisis May 21, 2026
- Chapter 154 - 0154 – Black Tortoise Adamantyl Armor (Part 2) May 21, 2026
- Chapter 153 - 0153 – Black Tortoise Adamantyl Armor (Part 1) May 21, 2026
- Chapter 152 - 0152 – Stunning, Regretful May 21, 2026
- Chapter 151 - 0151 – The Ultimate Challenge May 21, 2026
- Chapter 150 - 0150 – Ambiguous Ante May 21, 2026
- Chapter 149 - 0149 – Cold War May 21, 2026
- Chapter 148 - 0148 – Elder’s Rage May 21, 2026
- Chapter 147 - 0147 – Devil Bow Reappears May 21, 2026
- Chapter 146 - 0146 – See Through The Conspiracy May 21, 2026
- Chapter 145 - 0145 – Encountering an Old Foe Once Again May 21, 2026
- Chapter 144 - 0144 – Winning Streak May 21, 2026
- Chapter 143 - 0143 – Impossible May 21, 2026
- Chapter 142 - 0142 - The Final Strike May 21, 2026
- Chapter 141 - 0141 – Small Bet May 21, 2026
- Chapter 140 - 0140 – Can’t Explain May 21, 2026
- Chapter 139 - 0139 – Race May 21, 2026
- Chapter 138 - 0138 – Fishing up a Fortune May 21, 2026
- Chapter 137 - 0137 – Martial Nephew May 21, 2026
- Chapter 136 - 0136 – Return May 21, 2026
- Chapter 135 - 0135 – Blue Star Fire Spirit May 21, 2026
- Chapter 134 - 0134 – Level-4 Alchemist May 21, 2026
- Chapter 133 - 0133 – Alchemist’s Assessment May 21, 2026
- Chapter 132 - 0132 – Hua Xiangyue May 21, 2026
- Chapter 131 - 0131 - Mark of the Dragoness May 21, 2026
- Chapter 130 - 0130 - White Dragon May 21, 2026
- Chapter 129 - 0129 - True Martial Realm May 21, 2026
- Chapter 128 - 0128 - Ruthless Devil Skill May 21, 2026
- Chapter 127 - 0127 - Bottleneck May 21, 2026
- Chapter 126 - 0126 - A Woman’s Heart May 21, 2026
- Chapter 125 - 0125 - Missing May 21, 2026
- Chapter 124 - 0124 - Liao Shaoyun May 21, 2026
- Chapter 123 - 0123 - Demanding Life Devil Bow May 21, 2026
- Chapter 122 - 0122 - Search For Dragon May 21, 2026
- Chapter 121 - 0121 - Fragrance City May 21, 2026
- Chapter 120 - 0120 - Azure Profound Fruit Tree May 21, 2026
- Chapter 119 - 0119 - Planting Tree May 21, 2026
- Chapter 118 - 0118 - Crazy Means May 21, 2026
- Chapter 117 - 0117 - Mercilessly May 21, 2026
- Chapter 116 - 0116 - Sensational Prowess May 21, 2026
- Chapter 115 - 0115 - Challenging the First Rank Inner Courty May 21, 2026
- Chapter 114 - 0114 - Makeup For Regret May 21, 2026
- Chapter 113 - 0113 - Get Together May 21, 2026
- Chapter 112 - 0112 - First Beauty May 21, 2026
- Chapter 111 - 0111 - Young Martial Uncle May 21, 2026
- Chapter 110 - 0110 - Hell May 21, 2026
- Chapter 109 - 0109 - Tai Chi Subduing Dragon Divine Exercise May 21, 2026
- Chapter 108 - 0108 - Huang Jitian May 21, 2026
- Chapter 107 - 0107 – Challenge Postponed May 21, 2026
- Chapter 106 - 0106 - First Ranked Inner Courtyard May 21, 2026
- Chapter 105 - 0105 - First Level May 21, 2026
- Chapter 104 - 0104 - Dragon Blood Dan May 21, 2026
- Chapter 103 - 0103 - Future Crisis May 21, 2026
- Chapter 102 - 0102 - Azure Dragon Slaughtering Devil Blade May 21, 2026
- Chapter 101 - 0101 - Fury May 21, 2026
- Chapter 100 - 0100 - Completion Stage May 21, 2026
- Chapter 99 - 0099 - Powerful Enemy May 21, 2026
- Chapter 98 - 0098 - Peerless Martial Sect May 21, 2026
- Chapter 97 - 0097 - Heavenly Dragon Treasure May 21, 2026
- Chapter 96 - 0096 - Receiving an Apprentice May 21, 2026
- Chapter 95 - 0095 - Competition Result May 21, 2026
- Chapter 94 - 0094 - Alchemy Competition May 21, 2026
- Chapter 93 - 0093 - Extreme Dan Courtyard May 21, 2026
- Chapter 92 - 0092 - Divine Martial Skill May 21, 2026
- Chapter 91 - 0091 - Inner Courtyard May 21, 2026
- Chapter 90 - 0090 - Détente May 21, 2026
- Chapter 89 - 0089 - Azure Profound Fruit May 21, 2026
- Chapter 88 - 0088 - Treasure Hunt May 21, 2026
- Chapter 87 - 0087 - Elder Courtyard May 21, 2026
- Chapter 86 - 0086 - Mysterious Realm May 21, 2026
- Chapter 85 - 0085 - Suicidal May 21, 2026
- Chapter 84 - 0084 - Does Not Give Up May 21, 2026
- Chapter 83 - 0083 - Dan Elder May 21, 2026
- Chapter 82 - 0082 - Revealed Power May 21, 2026
- Chapter 81 - 0081 - Equally matched May 21, 2026
- Chapter 80 - 0080 - Outer Courtyard First Disciple May 21, 2026
- Chapter 79 - 0079 - Outer Martial Courtyard May 21, 2026
- Chapter 78 - 0078 - 3000 Martial Courtyard May 21, 2026
- Chapter 77 - 0077 - Asking for Trouble May 21, 2026
- Chapter 76 - 0076 - Avenge Personal Enmity In The Name Of Pu May 21, 2026
- Chapter 75 - 0075 - Extreme Martial Province May 21, 2026
- Chapter 74 - 0074 - Entrance Fee May 21, 2026
- Chapter 73 - 0073: Succeeded May 21, 2026
- Chapter 72 - 0072: Big Harvest May 21, 2026
- Chapter 71 - 0071: New Road May 21, 2026
- Chapter 70 - 70: Inheritance Bead May 21, 2026
- Chapter 69 - 69: Surprise May 21, 2026
- Chapter 68 - 68: Jiu Duzhi May 21, 2026
- Chapter 67 - 67: Martial Spirit May 21, 2026
- Chapter 66 - 66 - Exterminating Dragon Divine Martial Skill May 21, 2026
- Chapter 65 - 65 -Jiudu Gang May 21, 2026
- Chapter 64 - 64 - Poisonous Needle May 21, 2026
- Chapter 63 - 63 - Alchemy Sufferings May 21, 2026
- Chapter 62 - 62 - True Elemental Dan May 21, 2026
- Chapter 61 - 61 - Forgone Conclusion May 21, 2026
- Chapter 60 - 60 - The White Tiger Divine Fist action May 21, 2026
- Chapter 59 - 59 - The Battle Starts May 21, 2026
- Chapter 58 - 58 - Prelude Of War May 21, 2026
- Chapter 57 - 57 - Skies Beyond Skies May 21, 2026
- Chapter 56 - 56 - Tit For Tat May 21, 2026
- Chapter 55 - 55: Dragon Martial Technique May 21, 2026
- Chapter 54 - 54: Sister May 21, 2026
- Chapter 53 - 53 - Vicious Hidden Weapon May 21, 2026
- Chapter 52 - 52 - Beauty Departs May 21, 2026
- Chapter 51 - 51 - Bloody Methods May 21, 2026
- Chapter 50 - 50 - Plot May 21, 2026
- Chapter 49 - 49 - Leng Youlan May 21, 2026
- Chapter 48 - 48: Divine Power Realm May 21, 2026
- Chapter 47 - 47: Exterminated May 21, 2026
- Chapter 46 - 46: New enemies and old debts May 21, 2026
- Chapter 45 - 45:Opening soon action May 21, 2026
- Chapter 44 - 44:Special Gift May 21, 2026
- Chapter 43 - 43:Devil exercise May 21, 2026
- Chapter 42 - 42 - Advance into Level 7 May 21, 2026
- Chapter 41 - 41:Flame dragon brilliant furnace action May 21, 2026
- Chapter 40 - 40:Fire Dragon Blood Jade May 21, 2026
- Chapter 39 - 39:Respect May 21, 2026
- Chapter 38 - 38:Dan King May 21, 2026
- Chapter 37 - 37:Generous Remuneration May 21, 2026
- Chapter 36 - 36: In front of the Yao Family May 21, 2026
- Chapter 35 - 35: Metal Spirit Fruit May 21, 2026
- Chapter 34 - 34: Temptation May 21, 2026
- Chapter 33 - 33: Hua Yueyun May 21, 2026
- Chapter 32 - 32: Sect’s disciple May 21, 2026
- Chapter 31 - 31: Manor Lord, Governor May 21, 2026
- Chapter 30 - 30: Teach a lesson May 21, 2026
- Chapter 29 - 29 - Danxiang Herbal Manor May 21, 2026
- Chapter 28 - 28: King City May 21, 2026
- Chapter 27 - 27: Killer May 21, 2026
- Chapter 26 - 26: Real stage May 21, 2026
- Chapter 25 - 25: Grand Uncle May 21, 2026
- Chapter 24 - 24: Violent attack May 21, 2026
- Chapter 23 - 23: Heavenly Tiger Storm Killing Fist May 21, 2026
- Chapter 22 - 22: Please Verify It! May 21, 2026
- Chapter 21 - 21: Divine Weapons Heavenly Empire May 21, 2026
- Chapter 20 - 0020 - A Prodigious Talent May 21, 2026
- Chapter 19 - 0019 - Baptizing Marrow Dan May 21, 2026
- Chapter 18 - 0018 - First Confrontation May 21, 2026
- Chapter 17 - 0017 - Martial arts sect May 21, 2026
- Chapter 16 - 0016 - Yao family May 21, 2026
- Chapter 15 - 0015 - Vermillion Bird Fire Wings May 21, 2026
- Chapter 14 - 0014 - Immortal and Devil Pool May 21, 2026
- Chapter 13 - 0013 - Five-Element Fusion May 21, 2026
- Chapter 12 - 0012 - Battle of Great Disparity May 21, 2026
- Chapter 11 - 11: Divine Exercise Strength Revealed May 21, 2026
- Chapter 10 - 0010 - I’ll Fight May 21, 2026
- Chapter 9 - 009 - Patriarch Selection Meeting May 21, 2026
- Chapter 8 - 008 - Successful Pill Refinement May 21, 2026
- Chapter 7 - 007 - Dragon Saliva Exercise May 21, 2026
- Chapter 6 - 006 - True Qi Flame May 21, 2026
- Chapter 5 - 005: Challenge May 21, 2026
- Chapter 4 - 004 - Divine Exercise of Four Symbols May 21, 2026
- Chapter 3 - 003 - Xue Xianxian May 21, 2026
- Chapter 2 - 002: Yin and Yang Divine Veins May 21, 2026
- Chapter 1 - 001 - Hell Spirit Grass May 21, 2026
Reviews
0 comments