Font Size
15px

Inside the gray dark abyss passageway.

Having escaped Flaming Sun Purgatory, Castor flew toward the upper Abyss levels at his top speed.

He was trying to rush back to surface level as quickly as possible.

He realized that his decision to attack Qin Lie at Flaming Sun Purgatory before his eight avatars had returned to peak form was too rash.

The reason he took action before he was ready was because he had learned that Qin Lie was taking action against his main soul.

He knew that his main soul was fused to Qin Lie’s Soul Altar, and he knew that Qin Lie wouldn’t be able to refine it easily. However, he still charged into Flaming Sun Purgatory despite knowing all this.

It was because he was afraid of Qin Lie. The boy was growing far too quickly.

He was worried that Qin Lie would grow to a point where his eight avatars at their peak form would still not be enough to suppress him.

That was why he came ahead of time.

But Qin Lie was clearly prepared for his arrival. Qin Hao, Ling Yushi, and the seven Devil Monarchs appeared one after another after he had arrived at Flaming Sun Purgatory.

This made him realize that Qin Lie wasn’t attacking his main soul because he was desperate. It was because he had lay an ambush for Castor to step into.

Still, he chose to believe in his own strength.

Unfortunately, Lieyan Yuan wasn’t able to control the eight Undying Titans or rob Qin Lie of the Flesh Filling Tombstone as planned!

Qin Lie was able to regain his footing as a result, and Tian Qi wasn’t able to aid him because Flaming Sun Purgatory had been shut off by the Galaxy Mirror.

At his current level, he felt powerless against Qin Lie and the seven Devil Monarchs.

In the end, he decided to endure just a bit longer.

“I’m almost ready. I still have three Great Lord of the Abyss hearts up there that I haven’t refined pletely. When my three weakened avatars return to full strength, my body after fusion will be nine thousand and nine hundred meters tall! There’s nothing I can’t defeat with my flesh and blood power then!”

He thought to himself while flying to the top of the abyss passageway.

Suddenly, a black hole appeared right in front of him.

“Rip!”

Qin Lie crawled out of the black hole and chuckled at him ominously.

“Galaxy Mirror!”

The mirror in Qin Lie’s hands glowed brightly, and the endless stars roaming inside the abyss passageway suddenly moved toward it.

There were countless star behind every black hole inside the abyss passageway. Every single one of them was providing the Galaxy Mirror with power.

However, the wounded Castor couldn’t borrow even a sliver of energy from the strangest place of the universe.

The reason? Abyss passageway was pletely devoid of abyss devil energy!

“Castor, I can’t believe you chose to leave through the abyss passageway. Have you lost your head?” Qin Lie laughed madly.

Flaming Sun Purgatory was still an Abyss level. It contained a huge amount of abyss devil energy.

Any Great Lord of the Abyss could absorb this energy to restore their own strength.

Qin Lie could, the seven Devil Monarchs could. Castor was no exception either.

Castor could constantly replenish his energy loss with abyss devil energy while fighting in Flaming Sun Purgatory.

Although he was losing energy way faster than he was regaining it, it was still better than fighting in the abyss passageway. It was because abyss devil energy did not exist in the abyss passageway, so there was nothing Castor could absorb to recover himself.

Of course, Qin Lie couldn’t restore his strength with abyss devil energy inside the abyss passageway either.

However, he had the Galaxy Mirror and the bloodline of Demon Spirits of Space and Time! And this place was their birthplace!

“Not good! He caught up to me!”

Castor’s heart sank when Qin Lie appeared in front of him and started gathering star energy using the Galaxy Mirror.

He immediately figured out what Qin Lie was plotting.

“No wonder, no wonder he didn’t chase me immediately…”

For the first time, fear appeared in Castor’s eyes. He even suspected that it was Qin Lie’s plan to drive him into the abyss passageway all along.

“If we were in Flaming Sun Purgatory, it would’ve taken a considerable amount of effort to kill you, even in your weakened state.” Qin Lie’s smile grew wider and wider. “Unfortunately, your reason left you the moment you lost your momentum. You know I have the Galaxy Mirror, but you still chose to escape through the abyss passageway. If this isn’t a prime example of losing your head, I don’t know what is.”

Castor’s expression changed again.

“Swhoosh swhoosh!”

The starlight converging onto the Galaxy Mirror transformed into many giant blades.

The blades made of starlight struck Castor dead on.

Hundreds of wounds were added to Castor’s eight thousand meter tall body in just an instant.

“I can’t let this go on! I’ll have to make a gamble!”

Castor flew evasively in order to dodge the barrage of starlight blades.

Now that he was only eight thousand meters tall, he might not have the upper hand in a melee fight against Qin Lie.

He had no choice but to take a risky gamble!

“Zzzt!”

Suddenly, traces of purple light appeared from a corner of Qin Lie’s Soul Altar.

Qin Lie’s pupils bulged when he realized that the dead soul domain where Castor’s main soul resided in was threatening to implode.

The purple crystal was Castor’s dead soul domain. It had bee one with his Soul Altar.

If the purple crystal exploded, then his Soul Altar might explode with it.

“Castor!” Qin Lie roared angrily.

“Heh, your Soul Altar and my main soul are in the same boat. If my main soul explodes, then your Soul Altar will explode as well!” Castor shouted with eyes full of madness. “If you push me any further than this, I’ll detonate my dead soul domain and kill my main soul and your Soul Altar! I know you have two more subsouls, I know you won’t die even if your Soul Altar is extinguished. However, I have eight avatars and eight subsouls myself! I’m not afraid of losing my main soul either!”

Castor was clearly ready to die with him!

“Stop!”

Qin Lie’s expression changed drastically. He had no choice but to stop attacking Castor.

It was clear that he was struggling with himself.

Castor had clearly gone insane. It was likely he would do exactly what he said if he was pushed too far.

If he detonated the purple crystal as he threatened, Qin Lie’s Soul Altar would shatter with it.

His Soul Altar contained the truths and laws of countless bloodlines, Heavenly Thunder Eradication, Blood Spirit Art, Frost Arts, the Flame Devil King's laws of fire and his main soul.

If he were to lose his Soul Altar, his loss would only be far greater than Castor’s!

He couldn’t have any harm e to his Soul Altar. He wasn’t willing to die with Castor.

“Let me go!” Castor shouted harshly.

You are reading Spirit Realm Chapter 1792: Have You Lost Your Head? on novel69. Use the chapter navigation above or below to continue reading the latest translated chapters.
Share with your friends
Library saves books to your account. Reading History saves recent chapters in this browser.
Continuous reading

You may also like

God of Slaughter cover
Same author

God of Slaughter

Ni Cang Tian ·Action

Growingupparentless,ShiYan,whowasleftwithalargeinheritancemoney,boreageneraldisinterestinlife. Theonlytimeshefeltalivewaswhenadrenalinecoursedthoro...

Great Demon King cover
Same author

Great Demon King

Ni Cang Tian ·Action

“IfIdon’tdie...IswearIwillactonallmyevilthoughts..” Notexactlyeveryone’stypicalthoughtwhenthey’reabouttodie.Whatwillacowardlyyoungmandowhenreincarn...

No reviews yet. Be the first reader to leave one.
Please create an account or sign in to post a comment.