Font Size
15px

“Shred!”

The last fiery mark inside the Flesh Filling Tombstone was refined.

Not a single trace of the soul marks Lieyan Yuan had embedded inside the Flesh Filling Tombstone was left behind.

The Flesh Filling Tombstone was finally Qin Lie’s once more!

“Tombstone Fusion Art!”

Qin Lie pushed the Flesh Filling Tombstone into his chest and merged with it immediately.

An infinite amount of refined flesh and blood energy gushed out of the Flesh Filling Tombstone and into Qin Lie’s whole body.

“Crack crack!”

Qin Lie’s seven-thousand-meter-tall body grew rapidly because of the newly-replenished energy.

In a short time, his body swelled to the height of eight thousand meters.

“What a terrifiying flesh and blood energy!”

“Flaming Sun Monarch! It’s the Flaming Sun Monarch’s aura!”

The seven Devil Monarchs led by Auston were still fighting against Castor. They were just barely able to hold back his attacks.

When they turned around to look at the source of the terrifying flesh and blood energy, they were shocked to find who it was.

“He’s still growing stronger!”

To the Molten Rock Monarch’s surprise, Qin Lie’s growth hadn’t ended yet. The youngest Devil Monarch had grown another couple hundred meters in just a moment.

“Boom!”

His body exuded majestic aura. His growth had finally stopped.

He was now nine thousand meters tall!

“Master!”

The eight Undying Titans, Miao Fengtian, Jiang An, and Vitas couldn’t stop themselves from shouting excitedly.

Qin Lie had clearly surpassed the level of a Devil Monarch. He was now as strong as Castor.

Moreover, Castor had to bine all eight of his avatars into one to surpass the seven Devil Monarchs!

“Castor!”

Qin Lie growled as purple flames and lightning spilled off his body. Then, he charged straight toward the enemy.

“Leave him to me!”

Millions of purple lightning bolts condensed into one thick storm of lightning and fire before invading the space Castor was in.

Castor’s space was filled with phantoms and wraiths. The aura of dead souls was incredibly dense.

However, lightning was the bane of all souls. It didn’t matter if it was a living soul or a dead soul, any soul without the protection of a body could be killed by lightning!

Qin Lie was well-versed in Heavenly Thunder Eradication, and in this moment it was if he had transformed into the Thunder Emperor of the human race. He charged toward Castor, an entire sky of lightning and thunder.

“Zzzt!”

All phantoms and wraiths that were struck by lightning let out a shrill scream of pain before extinguishing like candle flames.

The laws and powers of dead souls in that area had also been shattered by Qin Lie’s lightning power.

The biggest lightning bolt of them all, Qin Lie, pierced through the fog of phantoms and crashed into Castor’s chest.

“Boom!”

Qin Lie and Castor started tearing into each other madly, the earth beneath them quaking.

“Zzzt!”

Countless wounds instantly appeared on both batants’ bodies.

Neither Qin Lie nor Castor were tough enough to ignore the other’s attacks.

Horrific wounds kept appearing on their giant bodies one after another.

The battle was so fierce that even their bones and hearts were peeking through their bloody flesh.

“Give me your refined blood!”

Qin Lie sent the order to the eight Undying Titans as a drop of his blood suddenly dripped out of a wound on his back of its own accord.

The eight Titans wordlessly bit their tongues and spat their blood at Qin Lie.

Their undying blood instantly merged with Qin Lie’s.

Qin Lie’s blood was the Perfect Blood!

The moment he absorbed the Titans’ undying blood, he could deconstruct its mysteries and obtain secrets hidden within.

It didn’t take long before he learned the secrets of the Titan’s undying blood!

The undying blood was said to be the bloodline with the highest recovery power. It was even superior to that of the Great Lords of the Abyss.

Thanks to his new foundings, Qin Lie was able to heal his wounds faster than ever before.

The seven Devil Monarchs quickly realized in astonishment that Qin Lie’s wounds were healing at a visible rate.

It was as if the skin, flesh, and muscles had bee a hundred times more active than before. It was almost as if the wounds were sewn together by millions of needles.

“Rip!”

Castor’s Abyss Devil tail cut through Qin Lie’s waist and left behind a horrific wound.

However, it took only a few seconds for it to heal pletely.

Castor was also healing the wounds Qin Lie had ripped on his body.

However, it was clearly slower pared to Qin Lie’s recovery speed.

As a result, Qin Lie’s open wounds no longer lost any blood after learning secrets of the Titan Race.

Any wound that wasn’t reopened by Castor started scabbing in no time.

Even the scabs looked like they would vanish pletely in just a couple of minutes.

The undying blood’s recovery speed had to be sustained by a huge amount of refined flesh and blood energy. However, Qin Lie had merged with the Flesh Filling Tombstone, so he had an entire ocean of flesh and blood energy to draw from.

He could use the Flesh Filling Tombstone’s energy to recover his wounds as quickly as possible.

This meant that his body was constantly invigorated, and his claws, his limbs, and his heart were always at their peak state when he fought Castor.

Castor couldn’t recover the damage dealt to his body as quickly as Qin Lie.

“Devilization Refinement!”

“Boom!”

Castor let out a shout before putting some distance between himself and Qin Lie.

He suddenly transformed into a giant flesh ball.

A flash later, the giant flesh ball turned back into Castor.

However, all the wounds on his body had magically vanished.

It was almost as if he had never been wounded.

One thing was different, however. Castor had bee shorter after his bizarre transformation.

He was now only about eight thousand meters tall!

The bigger an Abyss Devil, the greater their flesh and blood energy.

However, Castor had shrank to just eight thousand meters. This meant that his flesh and blood energy was now weaker than Qin Lie’s.

“Qin Lie! Devilization Refinement is a healing ability that restores the body pletely at the cost of a great amount of flesh and blood energy!” Auston said with a chuckle. “This means that the damage you dealt to him is starting to show! Push him harder and make him shrink to seven thousand meters, and even the seven of us can deal with him ourselves!”

“Alright!” Qin Lie roared and charged Castor again.

Castor shot Qin Lie a cold look before glaring at Auston. Then, he escaped toward the abyss passageway without a word.

However, inside Qin Lie’s Soul Altar, Castor shouted from his dead soul domain, “You can’t do anything to my main soul! When my body returns to peak form, you will be replaced by me!”

“Castor is escaping!”

“Stop him!”

“Don’t let him escape!”

All the Devil Monarchs hurriedly cried out a warning. They all noticed what Castor was planning.

“Whoosh!”

However, it took Castor only an instant to escape Qin Lie’s zone and fly straight toward the abyss passageway.

Not even Castor could tear open a spatial rift and leave through it due to the Galaxy Mirror.

Therefore, he had no choice but to escape through the abyss passageway.

“Qin Lie! Stop him!” Auston shouted anxiously.

“He’s escaping toward the abyss passageway, the abyss passageway! Heh!” Qin Lie said before laughing strangely.

He could clearly sense the Galaxy Mirror’s excitement the moment Castor left Flaming Sun Purgatory and entered the abyss passageway!

You are reading Spirit Realm Chapter 1791: Crazed Melee! on novel69. Use the chapter navigation above or below to continue reading the latest translated chapters.
Share with your friends
Library saves books to your account. Reading History saves recent chapters in this browser.
Continuous reading

You may also like

The Purgatory Calamity cover
Same author

The Purgatory Calamity

Ni Cang Tian ·Eastern

TheyoungPangJianwasforcedtoascendtotheheavens. …… ps:ThisisNiCangtian’snewworkafter“GodOfSlaughter”and“SpiritRealm”. Source:Webnovel.com,updatedonN...

God of Slaughter cover
Same author

God of Slaughter

Ni Cang Tian ·Action

Growingupparentless,ShiYan,whowasleftwithalargeinheritancemoney,boreageneraldisinterestinlife. Theonlytimeshefeltalivewaswhenadrenalinecoursedthoro...

Mage Manual cover
Similar genre

Mage Manual

Listening Day ·Fantasy

Ashopenedhiseyestofindthathehadtraveledtoastrangenationofmanyraces,andpeoplewerekneelingbeforehim.BeforehehadtimetoadapttothenewidentityoftheTermin...

Above The Sky cover
Similar genre

Above The Sky

Gloomy Sky Hidden God ·Fantasy

Thefirststarthatpassedawayextinguishedtwothousandyearsago. Fourhundredyearslater,themysteriousCalamityofHeavenlyFalldestroyedthecivilizationofthepr...

No reviews yet. Be the first reader to leave one.
Please create an account or sign in to post a comment.