Synopsis
Growingupparentless,ShiYan,whowasleftwithalargeinheritancemoney,boreageneraldisinterestinlife.
Theonlytimeshefeltalivewaswhenadrenalinecoursedthoroughhisveins.Hequicklyfoundthatextremesports,bungyjumping,cavediving&skydiving,gavehimthebiggestkicks.Thebiggertheadrenalinekick,thecloserhewastodeath,themorealivehefelt.
Wakingupinapileofdeadbodiesinanunknownland,afteradivingadventurehadendeddisastrously,hequicklyrealizesthebodyhenowpossessedwasnothisown.
FollowShiYanasheexploresthisnewworldwheredangerlurksaroundeverycorner,anddeathisonlyabreathaway;aworldinwhichShiYancouldnotfeelanymorealive.
Readers Also Like
The Purgatory Calamity
TheyoungPangJianwasforcedtoascendtotheheavens. …… ps:ThisisNiCangtian’snewworkafter“GodOfSlaughter”and“SpiritRealm”. Source:Web...
Great Demon King
“IfIdon’tdie...IswearIwillactonallmyevilthoughts..” Notexactlyeveryone’stypicalthoughtwhenthey’reabouttodie.Whatwillacowardlyyo...
Cultivating Disciples to Breakthrough
Withinaquietpavilionontopofalonelymountainpeak,XuanHaoslowlyopenedhiseyeswithabewilderedlookonhisface,hehadtransmigratedintoacu...
Swordless Demonic Path
"Thatchildisabitpeculiar,differentfromtheothers.Hefeelspainbutdoesn'tsayithurts,andheknowsjoybutdoesn'tlaugh.Hemusthavesademoti...
I Ascend to the Divine Throne through Arcane Means
Thetop-tierprofessionalplayerLiswokeuptofindhimselfhavingcrossedintothe“DivineRevelation”game,becomingaViscountenamoredwithmagi...
Divine Emperor of Death
TianLongwasbornanorphan.Heledhislifeinmiserywhileoutofnowhere,hechanceduponaDeathNote,killinghisonlyenemywhowasthecauseforhismi...
Chapters 1618
- Chapter 1618 - Eternal immortal (Finished) May 21, 2026
- Chapter 1617 - Endless sorrow May 21, 2026
- Chapter 1616 - Blood fusion May 21, 2026
- Chapter 1615 - Awakening May 21, 2026
- Chapter 1614 - Power of natural law and order May 21, 2026
- Chapter 1613 - Origin of life May 21, 2026
- Chapter 1612 - Absolute Beginning’s Soul Consciousness May 21, 2026
- Chapter 1611 - Desolate’s Greatest Extreme Ancient Extinguis May 21, 2026
- Chapter 1610 - Insufficient May 21, 2026
- Chapter 1609 - Space’s broken! Shi Yan gets out! May 21, 2026
- Chapter 1608 - Shake the entire world! May 21, 2026
- Chapter 1607 - Meet up May 21, 2026
- Chapter 1606 - Swallow Devour! May 21, 2026
- Chapter 1605 - Achieving supreme enlightenment May 21, 2026
- Chapter 1604 - Falsify destiny! May 21, 2026
- Chapter 1603 - Swallow each other May 21, 2026
- Chapter 1602 - Evil clone! May 21, 2026
- Chapter 1601 - Survival of the fittest May 21, 2026
- Chapter 1600 - Racing against time! May 21, 2026
- Chapter 1599 - The originator of all evils May 21, 2026
- Chapter 1598 - Divine weapon! May 21, 2026
- Chapter 1597 - Swallow everything! May 21, 2026
- Chapter 1596 - One idea to give birth to the world May 21, 2026
- Chapter 1595 - Heaven never bars your way! May 21, 2026
- Chapter 1594 - The road of fusion May 21, 2026
- Chapter 1593 - Clones gather May 21, 2026
- Chapter 1592 - The battle on the glacier May 21, 2026
- Chapter 1591 - Searching May 21, 2026
- Chapter 1590 - The so-called opportunity May 21, 2026
- Chapter 1589 - Principle of Power Upanishads May 21, 2026
- Chapter 1588 - Open the Gate May 21, 2026
- Chapter 1587 - Arrive at the abyss May 21, 2026
- Chapter 1586 - Ten thousand bodies May 21, 2026
- Chapter 1585 - Sauronâs invitation May 21, 2026
- Chapter 1584 - Increase sharply! May 21, 2026
- Chapter 1583 - Shi Yan mends the sky! May 21, 2026
- Chapter 1582 - The Territory Shatters! May 21, 2026
- Chapter 1581 - The Consciousness Arrives! May 21, 2026
- Chapter 1580 - Soul attack! May 21, 2026
- Chapter 1579 - Smelting May 21, 2026
- Chapter 1578 - Head to the Holy Land May 21, 2026
- Chapter 1577 - Prevailing trend May 21, 2026
- Chapter 1576 - Establish the world May 21, 2026
- Chapter 1575 - Endless Abyss May 21, 2026
- Chapter 1574 - Ensure the victory May 21, 2026
- Chapter 1573 - Create a Miracle! May 21, 2026
- Chapter 1572 - Eternal Seal! May 21, 2026
- Chapter 1571 - Brutal Battlefield May 21, 2026
- Chapter 1570 - Riot the Sea of Stars May 21, 2026
- Chapter 1569 - Vie for the Territory Souls! May 21, 2026
- Chapter 1568 - The Gate of Plundering May 21, 2026
- Chapter 1567 - Raid Huanglong directly! May 21, 2026
- Chapter 1566 - Reverse! May 21, 2026
- Chapter 1565 - Use one to resist ten thousand! May 21, 2026
- Chapter 1564 - Disseminate God power May 21, 2026
- Chapter 1563 - Is it doomsday? May 21, 2026
- Chapter 1562 - Shoulder great responsibilities! May 21, 2026
- Chapter 1561 - Invincible! Invincible! May 21, 2026
- Chapter 1560 - The Second Sky of Territory Ancestor Realm! May 21, 2026
- Chapter 1559 - Dogfight May 21, 2026
- Chapter 1558 - Rampage to Break the Challenge! May 21, 2026
- Chapter 1557 - Desperate Straits! May 21, 2026
- Chapter 1556 - Drink Blood and Eat Flesh May 21, 2026
- Chapter 1555 - Ambush May 21, 2026
- Chapter 1554 - Zhen Ru May 21, 2026
- Chapter 1553 - The Great Race War May 21, 2026
- Chapter 1552 - The Title of God of Slaughter! May 21, 2026
- Chapter 1551 - Sweep Away Many Clans May 21, 2026
- Chapter 1550 - A New Original Symbol! May 21, 2026
- Chapter 1549 - Muster a Large Force May 21, 2026
- Chapter 1548 - Great Shock May 21, 2026
- Chapter 1547 - Court Death May 21, 2026
- Chapter 1546 - Fire Bathing Phoenix May 21, 2026
- Chapter 1545 - Absolute Beginning! May 21, 2026
- Chapter 1544 - Dispel Doubts May 21, 2026
- Chapter 1543 - The Agreement in the Past May 21, 2026
- Chapter 1542 - Disclose Feelings May 21, 2026
- Chapter 1541 - Zi Yao is Born Again! May 21, 2026
- Chapter 1540 - Fearfully Barbarian May 21, 2026
- Chapter 1539 - Borrow Power! May 21, 2026
- Chapter 1538 - Savage Yuan May 21, 2026
- Chapter 1537 - Flawless Calculation May 21, 2026
- Chapter 1536 - Turning Hostile May 21, 2026
- Chapter 1535 - Get Zi Yao Back! May 21, 2026
- Chapter 1534 - Move the Mountains and Overthrow the Seas May 21, 2026
- Chapter 1533 - Restlessly Impatient May 21, 2026
- Chapter 1532 - Tranquil Mind May 21, 2026
- Chapter 1531 - Yuan Zu May 21, 2026
- Chapter 1530 - Pure Gold Spirit Ant May 21, 2026
- Chapter 1529 - Dreadful Might Fills the Sky! May 21, 2026
- Chapter 1528 - Trample! May 21, 2026
- Chapter 1527 - Retaliation Starts From You! May 21, 2026
- Chapter 1526 - Surpass Bloodthirsty! May 21, 2026
- Chapter 1525 - The World-destroying Might May 21, 2026
- Chapter 1524 - Fierce May 21, 2026
- Chapter 1523 - Territory Ancestor May 21, 2026
- Chapter 1522 - Permeating May 21, 2026
- Chapter 1521 - The Natural Space Wall May 21, 2026
- Chapter 1520 - Beseech Battle! May 21, 2026
- Chapter 1519 - Troublesome May 21, 2026
- Chapter 1518 - Skyfall Star River Absolute Beginning Divine May 21, 2026
- Chapter 1517 - Cloud Mist Territory May 21, 2026
- Chapter 1516 - Sauron May 21, 2026
- Chapter 1515 - Great Seal! May 21, 2026
- Chapter 1514 - Do Not Return May 21, 2026
- Chapter 1513 - A Random Encounter May 21, 2026
- Chapter 1512 - To the Heart’s Content, Staying at Present! May 21, 2026
- Chapter 1511 - The Original Symbol Embryo May 21, 2026
- Chapter 1510 - Leave No One Alive! May 21, 2026
- Chapter 1509 - Discharge Resentment! May 21, 2026
- Chapter 1508 - The Light in the Desperate Straits May 21, 2026
- Chapter 1507 - Anger Against a Common Enemy May 21, 2026
- Chapter 1506 - Drifting Far Away May 21, 2026
- Chapter 1505 - Bloodthirsty’s Last Words May 21, 2026
- Chapter 1504 - The Path Ahead May 21, 2026
- Chapter 1503 - Great Seal Technique May 21, 2026
- Chapter 1502 - Time has changed May 21, 2026
- Chapter 1501 - The Absolute Beginning Gateway May 21, 2026
- Chapter 1500 - Thing returns to its rightful owner May 21, 2026
- Chapter 1499 - Walk on the road of fusion! May 21, 2026
- Chapter 1498 - Foresight May 21, 2026
- Chapter 1497 - Wipe out the entire world! May 21, 2026
- Chapter 1496 - The Ark! May 21, 2026
- Chapter 1495 - The day the star area ends! May 21, 2026
- Chapter 1494 - The true body arrives! May 21, 2026
- Chapter 1493 - I saw that I died! May 21, 2026
- Chapter 1492 May 21, 2026
- Chapter 1491 - Are you her? May 21, 2026
- Chapter 1490 - Alarm! May 21, 2026
- Chapter 1489 - Third Sky of Immortal Realm! May 21, 2026
- Chapter 1488 - Swallow! May 21, 2026
- Chapter 1487 - The reversed flow of time! May 21, 2026
- Chapter 1486 - Strength of the Territory Master May 21, 2026
- Chapter 1485 - You’re not qualified! May 21, 2026
- Chapter 1484 - The battle that lasts ten thousand years May 21, 2026
- Chapter 1483 - Predestined enemy! May 21, 2026
- Chapter 1482 - Reach an agreement May 21, 2026
- Chapter 1481 - Gather by the territory entrance May 21, 2026
- Chapter 1480 - Ignite May 21, 2026
- Chapter 1479 - Link up the territories May 21, 2026
- Chapter 1478 - The Dark Abyss May 21, 2026
- Chapter 1477 - Goddess Mother May 21, 2026
- Chapter 1476 - New structure May 21, 2026
- Chapter 1475 - Return! May 21, 2026
- Chapter 1474 May 21, 2026
- Chapter 1473 - Apprehend the Creation May 21, 2026
- Chapter 1472 - Awaken One By One May 21, 2026
- Chapter 1471 - Desolate Territory’s Outer Layer May 21, 2026
- Chapter 1470 - Shaking Fallout May 21, 2026
- Chapter 1469 - Sky and Earth Turning Upside Down! May 21, 2026
- Chapter 1468 - Yin and Yang - Left and Right May 21, 2026
- Chapter 1467 - Constellation Power! May 21, 2026
- Chapter 1466 - Are You Still Sleepy? May 21, 2026
- Chapter 1465 - Wage War Everywhere! May 21, 2026
- Chapter 1464 - Return! May 21, 2026
- Chapter 1463 - Exposed One By One May 21, 2026
- Chapter 1462 - Free Fight! May 21, 2026
- Chapter 1461 - Lord of All Stars! May 21, 2026
- Chapter 1460 - All Dreadful Devils Come! May 21, 2026
- Chapter 1459 - One Gets Through, All Gets Through! May 21, 2026
- Chapter 1458 - Clash of Territories! May 21, 2026
- Chapter 1457 - Enlightened by the Broken Star May 21, 2026
- Chapter 1456 - It’s the Will of Heaven May 21, 2026
- Chapter 1455 - Fierce Outbreak! May 21, 2026
- Chapter 1454 - Bloodshed on the Seabed May 21, 2026
- Chapter 1453 - The Space Cross Slash May 21, 2026
- Chapter 1452 - Emperor Sea Shark May 21, 2026
- Chapter 1451 - Hiro! May 21, 2026
- Chapter 1450 - Deny Flatly May 21, 2026
- Chapter 1449 - Run Into May 21, 2026
- Chapter 1448 - Capture May 21, 2026
- Chapter 1447 - Disguise and Sneak May 21, 2026
- Chapter 1446 - Massacre the Entire Island May 21, 2026
- Chapter 1445 - Be an Obedient Woman May 21, 2026
- Chapter 1444 - Mei Ji’s Harvest May 21, 2026
- Chapter 1443 - Mistakenly Hit! May 21, 2026
- Chapter 1442 - Bewitch May 21, 2026
- Chapter 1441 - Part and Take Action! May 21, 2026
- Chapter 1440 - Wantonly Massacre! May 21, 2026
- Chapter 1439 - The Entire Sea of Annihilation is Surging! May 21, 2026
- Chapter 1438 - Mei Ji’s Boldness! May 21, 2026
- Chapter 1437 - Frantic Suppression! May 21, 2026
- Chapter 1436 - A Strong Current May 21, 2026
- Chapter 1435 - Enjoy a Carefree Meal! May 21, 2026
- Chapter 1434 - Invincible Might from the Sky! May 21, 2026
- Chapter 1433 - Surging Vitality! May 21, 2026
- Chapter 1432 - Collect! May 21, 2026
- Chapter 1431 - You Are Still Unskilled! May 21, 2026
- Chapter 1430 - Among What is True and What is False May 21, 2026
- Chapter 1429 - Must Vie For it! May 21, 2026
- Chapter 1428 - Rise the Might in the Foreign Land May 21, 2026
- Chapter 1427 - The Ultimate Power Upanishad! May 21, 2026
- Chapter 1426 - The Absolute Beginning Original Symbol! May 21, 2026
- Chapter 1425 - It is… Life! May 21, 2026
- Chapter 1424 - I Don’t Dare to Make That Step May 21, 2026
- Chapter 1423 - Meet Old Friends May 21, 2026
- Chapter 1422 - Penetrate! May 21, 2026
- Chapter 1421 - The Ruins Under the Sea May 21, 2026
- Chapter 1420 - She’s My Woman! May 21, 2026
- Chapter 1419 - Sly Change! May 21, 2026
- Chapter 1418 - Cannon Fodder? May 21, 2026
- Chapter 1417 - Go Together May 21, 2026
- Chapter 1416 - The Call from the Seabed May 21, 2026
- Chapter 1415 - Also a Pitiful Woman May 21, 2026
- Chapter 1414 - Separate May 21, 2026
- Chapter 1413 - Waiting for a Man May 21, 2026
- Chapter 1412 - The Sea of Annihilation May 21, 2026
- Chapter 1411 - Shadow May 21, 2026
- Chapter 1410 - Power Upanishad Superiority May 21, 2026
- Chapter 1409 - Bully the Beauty May 21, 2026
- Chapter 1408 - Counterattack! May 21, 2026
- Chapter 1407 - Join Hands May 21, 2026
- Chapter 1406 - Detoxify! May 21, 2026
- Chapter 1405 - Mysterious Yin Corpse Worm May 21, 2026
- Chapter 1404 - The Real Origin of the Soul Inside the Ring May 21, 2026
- Chapter 1403 - Parents’ Love May 21, 2026
- Chapter 1402 - A Turn for the Better! May 21, 2026
- Chapter 1401 - A Little Skeleton May 21, 2026
- Chapter 1400 - Skull Island May 21, 2026
- Chapter 1399 - Fortune May 21, 2026
- Chapter 1398 - Soul as the Sea May 21, 2026
- Chapter 1397 - Turn the Situation Around! May 21, 2026
- Chapter 1396 - World Within World May 21, 2026
- Chapter 1395 - A Matter of Life or Death May 21, 2026
- Chapter 1394 - Dragon Lizard’s True Body May 21, 2026
- Chapter 1393 - Goddess’ Gorgeous Dance May 21, 2026
- Chapter 1392 - Conceal May 21, 2026
- Chapter 1391 - Lord of All Skies May 21, 2026
- Chapter 1390 - Instigate May 21, 2026
- Chapter 1389 - Immortal Realm! May 21, 2026
- Chapter 1388 - Conflict May 21, 2026
- Chapter 1387 - Festival May 21, 2026
- Chapter 1386 - Cut the Flesh May 21, 2026
- Chapter 1385 - Break the Bottleneck May 21, 2026
- Chapter 1384 - Reward May 21, 2026
- Chapter 1383 - Soul Refining Cauldron May 21, 2026
- Chapter 1382 - Twisting and Turning May 21, 2026
- Chapter 1381 - You Think You Can Run Away? May 21, 2026
- Chapter 1380 - Lead the Wolf Into the House May 21, 2026
- Chapter 1379 - Ten Great Territory Ancestors May 21, 2026
- Chapter 1378 - The Fascinating Divine Eye May 21, 2026
- Chapter 1377 - Lost May 21, 2026
- Chapter 1376 - Reflected Glory May 21, 2026
- Chapter 1375 - Boldness of Vision May 21, 2026
- Chapter 1374 May 21, 2026
- Chapter 1373 - Unlock the Spatial Lock May 21, 2026
- Chapter 1372 - Fantasy Boundary Stone May 21, 2026
- Chapter 1371 - Trade for Items May 21, 2026
- Chapter 1370 - Forefather Dragon Lizard May 21, 2026
- Chapter 1369 - Immortal Pellet May 21, 2026
- Chapter 1368 - The Seven Great Races May 21, 2026
- Chapter 1367 - Ming Hong May 21, 2026
- Chapter 1366 - A Derelict Item May 21, 2026
- Chapter 1365 - An Absolute Beginning weapon? May 21, 2026
- Chapter 1364 - Dragon Lizard Clan May 21, 2026
- Chapter 1363 - A Bad Hand Destroys the Flower May 21, 2026
- Chapter 1362 - Lord of Stars! May 21, 2026
- Chapter 1361 - The First Battle in the Sea Domain! May 21, 2026
- Chapter 1360 - Three Kinds of Living Beings May 21, 2026
- Chapter 1359 - Heavenly Eye Clan May 21, 2026
- Chapter 1358 - The Absolute Beginning Symbols May 21, 2026
- Chapter 1357 - A Three-legged Jade Cauldron May 21, 2026
- Chapter 1356 - Using Blood to Create the Body May 21, 2026
- Chapter 1355 - The Asteroid Current May 21, 2026
- Chapter 1354 - The Long, Lonesome Days May 21, 2026
- Chapter 1353 - The Sea Domain of Nihility May 21, 2026
- Chapter 1352 - Causes and Effects May 21, 2026
- Chapter 1351 - A Bloody Battle May 21, 2026
- Chapter 1350 - The Twelve-headed Serpent May 21, 2026
- Chapter 1349 - Mistress May 21, 2026
- Chapter 1348 - That power! May 21, 2026
- Chapter 1347 - The Life Magnetic Field Rockets! May 21, 2026
- Chapter 1346 - Hui Counterattacks! May 21, 2026
- Chapter 1345 - New power! May 21, 2026
- Chapter 1344 - Soul Congregating May 21, 2026
- Chapter 1343 - God Lord May 21, 2026
- Chapter 1342 - Hui (*) May 21, 2026
- Chapter 1341 - Transform! May 21, 2026
- Chapter 1340 May 21, 2026
- Chapter 1339 - Good Fortune Fills Up to the Sky May 21, 2026
- Chapter 1338 - Frantic Bursting! May 21, 2026
- Chapter 1337 - Doomsday is Coming! May 21, 2026
- Chapter 1336 - The Unsolved Riddle May 21, 2026
- Chapter 1335 - Living in the Sheep Pasture May 21, 2026
- Chapter 1334 May 21, 2026
- Chapter 1333: Gigantic Worm May 21, 2026
- Chapter 1332: Refine May 21, 2026
- Chapter 1331: The Big Meatball May 21, 2026
- Chapter 1330: The Anonymous Evil Thing May 21, 2026
- Chapter 1329: Sly Land May 21, 2026
- Chapter 1328: Walking Free May 21, 2026
- Chapter 1327: Outer Space Divine Light May 21, 2026
- Chapter 1326: Warm Their Hearts May 21, 2026
- Chapter 1325: He’s My Man May 21, 2026
- Chapter 1324: Lead the Evil Around May 21, 2026
- Chapter 1323: Set Up Earth and Heaven May 21, 2026
- Chapter 1322: Collapsed and Destroyed! May 21, 2026
- Chapter 1321: Unrivalled Great Devil! May 21, 2026
- Chapter 1320: Death and Life Rotating Bridge May 21, 2026
- Chapter 1319: Erode the Entire World May 21, 2026
- Chapter 1318: Crazily Spread Out! May 21, 2026
- Chapter 1317: Wederson Rampages! Shi Yan is About to Explode May 21, 2026
- Chapter 1316: Deadly Field May 21, 2026
- Chapter 1315: Tough Encounter! May 21, 2026
- Chapter 1314: Bite and Nibble! May 21, 2026
- Chapter 1313: Come to the Frontline With Me! May 21, 2026
- Chapter 1312: The Master Arrives May 21, 2026
- Chapter 1311: General Situation May 21, 2026
- Chapter 1310: The Same Gateway May 21, 2026
- Chapter 1309: A Showdown of Immortal Realm Experts! May 21, 2026
- Chapter 1308: Old Friends Reunite May 21, 2026
- Chapter 1307: Lei Di and Qing Xiao (Bright Lightning and Azu May 21, 2026
- Chapter 1306: Ignite the Flame of Life! May 21, 2026
- Chapter 1305: Thunder Dragon’s Skeleton May 21, 2026
- Chapter 1304: Human Nature May 21, 2026
- Chapter 1303: Candid Counterpart May 21, 2026
- Chapter 1302: A New Life! May 21, 2026
- Chapter 1301: Self-Freezing May 21, 2026
- Chapter 1300: Gambling May 21, 2026
- Chapter 1299: One is Enough May 21, 2026
- Chapter 1298: One vs. Two May 21, 2026
- Chapter 1297: Rush to the Tiger’s Den May 21, 2026
- Chapter 1296: Human Head Feast May 21, 2026
- Chapter 1295: A Blood Reeking Journey May 21, 2026
- Chapter 1294: Risk Life! May 21, 2026
- Chapter 1293: Slaughter May 21, 2026
- Chapter 1292: The Chen family May 21, 2026
- Chapter 1291: DeCarlos May 21, 2026
- Chapter 1290: Life Sublimation May 21, 2026
- Chapter 1289: Unyielding May 21, 2026
- Chapter 1288: Carefree May 21, 2026
- Chapter 1287: Clearly See the Crisis May 21, 2026
- Chapter 1286: Profound Comprehension May 21, 2026
- Chapter 1285: An Ambiguous Relationship May 21, 2026
- Chapter 1284: Who is He After All? May 21, 2026
- Chapter 1283: My Woman! May 21, 2026
- Chapter 1282: Overbearing May 21, 2026
- Chapter 1281: Posturing? May 21, 2026
- Chapter 1280: Guard the Tree Stump and Wait for the Rabbit May 21, 2026
- Chapter 1279: Primordial Spirit Lock May 21, 2026
- Chapter 1278: Teasing May 21, 2026
- Chapter 1277: You are not Qualified! May 21, 2026
- Chapter 1276: Open the Space May 21, 2026
- Chapter 1275: Fantasy Zone May 21, 2026
- Chapter 1274: Heavenly King Light May 21, 2026
- Chapter 1273: An Earth-shaking Conjecture May 21, 2026
- Chapter 1272: Seal May 21, 2026
- Chapter 1271: The Ring Spirit May 21, 2026
- Chapter 1270: You’re Not It! May 21, 2026
- Chapter 1269: Sudden Change May 21, 2026
- Chapter 1268: Compete for the Chief Position May 21, 2026
- Chapter 1267: Empower May 21, 2026
- Chapter 1266: The Three Great Chiefs May 21, 2026
- Chapter 1265: There’s an Energy May 21, 2026
- Chapter 1264: The Bloodthirsty’s Statue May 21, 2026
- Chapter 1263: Frantic May 21, 2026
- Chapter 1262: Step into the Blood Sea May 21, 2026
- Chapter 1261: Commit May 21, 2026
- Chapter 1260: My World! May 21, 2026
- Chapter 1259: The Heavenly Monster Tribe’s Perfect Plan May 21, 2026
- Chapter 1258: I’m the Master! May 21, 2026
- Chapter 1257: Reunite May 21, 2026
- Chapter 1256: The Blood Imperial Order May 21, 2026
- Chapter 1255: The Cortege of Eight May 21, 2026
- Chapter 1254: Senro – Chief of Despair Force May 21, 2026
- Chapter 1253: The Ring Spirit’s Fixation May 21, 2026
- Chapter 1252: Blood Sea, Bone Islands May 21, 2026
- Chapter 1251: Struggle to Escape! May 21, 2026
- Chapter 1250: Internal Strife? May 21, 2026
- Chapter 1249: A Coffin May 21, 2026
- Chapter 1248: Compete for a Seat May 21, 2026
- Chapter 1247: Go to the Next Level May 21, 2026
- Chapter 1246: God Lord’s Soul Arrives May 21, 2026
- Chapter 1245: Frederick May 21, 2026
- Chapter 1244: Devouring! May 21, 2026
- Chapter 1243: Fusing power Upanishads! May 21, 2026
- Chapter 1242: Outstanding Heroes Stir Up! May 21, 2026
- Chapter 1241: Meticulous Arrangement May 21, 2026
- Chapter 1240: Puzzled May 21, 2026
- Chapter 1239: One Finger May 21, 2026
- Chapter 1238: Bloodthirsty’s Aura May 21, 2026
- Chapter 1237: A Small Jade Box May 21, 2026
- Chapter 1236: Black Iron City May 21, 2026
- Chapter 1235: The Tsunami Chamber of Commerce May 21, 2026
- Chapter 1234: Fulfill the Promise May 21, 2026
- Chapter 1233: Unyielding May 21, 2026
- Chapter 1232: Immortal May 21, 2026
- Chapter 1231: Mega Work! May 21, 2026
- Chapter 1230: Fame May 21, 2026
- Chapter 1229: Return with a Whole Life Star! May 21, 2026
- Chapter 1228: Chaos Appears May 21, 2026
- Chapter 1227: Create the Miracle! May 21, 2026
- Chapter 1226: The Monster Ancestor’s Blood Sacrifice! May 21, 2026
- Chapter 1225: The Azure Dragon Wakes Up May 21, 2026
- Chapter 1224: Just Like That Year May 21, 2026
- Chapter 1223: Great Victory! May 21, 2026
- Chapter 1222: End of the Legend May 21, 2026
- Chapter 1221: Bloody Fight May 21, 2026
- Chapter 1220: Don’t Wanna Be a Dog Anymore! May 21, 2026
- Chapter 1219: Who’s Your Teacher? May 21, 2026
- Chapter 1218: The Second Strong Hit! May 21, 2026
- Chapter 1217: The God Punishment’s Reduced Power May 21, 2026
- Chapter 1216: The God Clan’s Great Slayer! May 21, 2026
- Chapter 1215: God Clan Requests Reinforcements May 21, 2026
- Chapter 1214: Mutant Bloodline May 21, 2026
- Chapter 1213: Clever May 21, 2026
- Chapter 1212: Burn the Soul May 21, 2026
- Chapter 1211: Great Boost For the Morale! May 21, 2026
- Chapter 1210: Well Fortified May 21, 2026
- Chapter 1209: Respect May 21, 2026
- Chapter 1208: Snatch Money! May 21, 2026
- Chapter 1207: Shake the Entire Sea of Stars! May 21, 2026
- Chapter 1206: Blood Devil’s Breakthrough May 21, 2026
- Chapter 1205: March to the Front! May 21, 2026
- Chapter 1204: It’s Good... that You Can Come Back! May 21, 2026
- Chapter 1203: The Style of That Slash! May 21, 2026
- Chapter 1202: Shi Yan Draws a Circle by the Blood Pond May 21, 2026
- Chapter 1201: The Boiling Blood Pond May 21, 2026
- Chapter 1200: The King is Back! May 21, 2026
- Chapter 1199: Experts Get Together May 21, 2026
- Chapter 1198: There’s a Force May 21, 2026
- Chapter 1197: Scheme Against the World! May 21, 2026
- Chapter 1196: World Famous May 21, 2026
- Chapter 1195: Sea Territory May 21, 2026
- Chapter 1194: Return May 21, 2026
- Chapter 1193: Awaken! May 21, 2026
- Chapter 1192: The One Who has Disappeared for Ten Years May 21, 2026
- Chapter 1191: The Structure of the World May 21, 2026
- Chapter 1190: The World Purifying Light! May 21, 2026
- Chapter 1189: The Burning Karma Flame May 21, 2026
- Chapter 1188: The Collision of the Two Worlds! May 21, 2026
- Chapter 1187: Sly Change! May 21, 2026
- Chapter 1186: Blood Sword Breaking Divine Boat May 21, 2026
- Chapter 1185: Replace the World! May 21, 2026
- Chapter 1184: The Cold Eye of a Bystander May 21, 2026
- Chapter 1183: I’m Helping You May 21, 2026
- Chapter 1182: Crazy Harson! May 21, 2026
- Chapter 1181: The World Tree May 21, 2026
- Chapter 1180: The Genesis Fruit May 21, 2026
- Chapter 1179: Destination May 21, 2026
- Chapter 1178: The Third Sky of Ethereal God Realm May 21, 2026
- Chapter 1177: It Seems Like a Dreamland May 21, 2026
- Chapter 1176: Wonderland May 21, 2026
- Chapter 1175: After Five Years! May 21, 2026
- Chapter 1174: The Remains of the Holy Beast White Tiger May 21, 2026
- Chapter 1173: Who You Used to be? May 21, 2026
- Chapter 1172: Harson’s Riddle May 21, 2026
- Chapter 1171: Resurrected? May 21, 2026
- Chapter 1170: Real Competence! May 21, 2026
- Chapter 1169: The Icy World May 21, 2026
- Chapter 1168: Show the Inferior Face to the Enemy May 21, 2026
- Chapter 1167: Healing! May 21, 2026
- Chapter 1166: Desolate’s Generous Gifts May 21, 2026
- Chapter 1165: Capture the Heart May 21, 2026
- Chapter 1164: A Separate-spatial Battle! May 21, 2026
- Chapter 1163: The Eight Great Chiefs May 21, 2026
- Chapter 1162: The Cradle of Mazes May 21, 2026
- Chapter 1161: Invest All the Affection May 21, 2026
- Chapter 1160: It’s Watching You May 21, 2026
- Chapter 1159: Refine the Ancient Continent? May 21, 2026
- Chapter 1158: Fusing Three Heaven Flames May 21, 2026
- Chapter 1157: Someone Lives, Someone Dies May 21, 2026
- Chapter 1156: Desolate May 21, 2026
- Chapter 1155: Cang Yun won’t Get the Worst of it May 21, 2026
- Chapter 1154: Burning Purgatory May 21, 2026
- Chapter 1153: The World of Five-colored Light May 21, 2026
- Chapter 1152: Frantic Showdown! May 21, 2026
- Chapter 1151: Immortal Body! May 21, 2026
- Chapter 1150: The Bloody Bone Has a New Owner May 21, 2026
- Chapter 1149: It’s the First One! May 21, 2026
- Chapter 1148: Seize Power! May 21, 2026
- Chapter 1147: Turn Earth and Heaven Around May 21, 2026
- Chapter 1146: Trust May 21, 2026
- Chapter 1145: White Bone Refining Blood Ghost Grave May 21, 2026
- Chapter 1144: The Charteris Family May 21, 2026
- Chapter 1143: A Samsara May 21, 2026
- Chapter 1142: Little Fatty May 21, 2026
- Chapter 1141: Refine the Ethereal Extent May 21, 2026
- Chapter 1140: The Scarlet Flaming Heart May 21, 2026
- Chapter 1139: Deadlock May 21, 2026
- Chapter 1138: Join Hands May 21, 2026
- Chapter 1137: Heavenly Monster Tribe and Imperial Dark Tribe May 21, 2026
- Chapter 1136: The Four Great Creatures May 21, 2026
- Chapter 1135: Cross the Border May 21, 2026
- Chapter 1134: Great Responsibility May 21, 2026
- Chapter 1133: Predestined Mortal Enemy May 21, 2026
- Chapter 1132: Who is the Backbone? May 21, 2026
- Chapter 1131: Achieve his Desire May 21, 2026
- Chapter 1130: Use the Old Trick Again May 21, 2026
- Chapter 1129: Instant Kill! May 21, 2026
- Chapter 1128: The Sudden Incident May 21, 2026
- Chapter 1127: Stealth May 21, 2026
- Chapter 1126: The Fearful Formation Under the Lake May 21, 2026
- Chapter 1125: Why Me All the Time? May 21, 2026
- Chapter 1124: Prepare the Ambush May 21, 2026
- Chapter 1123: Getting Serious! May 21, 2026
- Chapter 1122: The Servant Flower and the Master Flower May 21, 2026
- Chapter 1121: Prevail May 21, 2026
- Chapter 1120: Shed All Pretense of Cordiality! May 21, 2026
- Chapter 1119: A Move to Change All May 21, 2026
- Chapter 1118: What Does it Matter to Me? May 21, 2026
- Chapter 1117: Hold Hostage! May 21, 2026
- Chapter 1116: Break the Barrier! May 21, 2026
- Chapter 1115: Pressing Earth and Heaven’s Prestige May 21, 2026
- Chapter 1114: Needlepoint vs Spearhead May 21, 2026
- Chapter 1113: Hidden Dragon Tying Sky May 21, 2026
- Chapter 1112: Destroy May 21, 2026
- Chapter 1111: Unvalued Little Fish May 21, 2026
- Chapter 1110: Are you All Mistaken? May 21, 2026
- Chapter 1109: Is He Really Strong? May 21, 2026
- Chapter 1108: The Five Great Territories May 21, 2026
- Chapter 1107: Refine the Fruit Tree May 21, 2026
- Chapter 1106: Change Again and Again May 21, 2026
- Chapter 1105: Awkward Exposition May 21, 2026
- Chapter 1104: The Brilliant Star Fruit Tree May 21, 2026
- Chapter 1103: Upset a Plan May 21, 2026
- Chapter 1102: The General Situation of the Sea of Stars May 21, 2026
- Chapter 1101: Hand in Hand May 21, 2026
- Chapter 1100: Break the Shackles May 21, 2026
- Chapter 1099: Soul Kalpa May 21, 2026
- Chapter 1098: Forcefully Seize May 21, 2026
- Chapter 1097: Panic and Upheaval! May 21, 2026
- Chapter 1096: A Sudden Fatal Attack! May 21, 2026
- Chapter 1095: Do You Have Some More? May 21, 2026
- Chapter 1094: The Gu God Sect (*) May 21, 2026
- Chapter 1093: Hundred Kalpa Ghost Hand Rattan May 21, 2026
- Chapter 1092: Refine Blood May 21, 2026
- Chapter 1091: Ancient Continent May 21, 2026
- Chapter 1090: Outstanding Talents May 21, 2026
- Chapter 1089: Desolate May 21, 2026
- Chapter 1088: Soul Rotting Aphids May 21, 2026
- Chapter 1087: Great Sage May 21, 2026
- Chapter 1086: The Fate Traveler May 21, 2026
- Chapter 1085: Soul Incantations May 21, 2026
- Chapter 1084: Gu He May 21, 2026
- Chapter 1083: Meditate and calm the soul May 21, 2026
- Chapter 1082: Talented Field Commander! May 21, 2026
- Chapter 1081: Link Up May 21, 2026
- Chapter 1080: Topple the beliefs May 21, 2026
- Chapter 1079: Better to fight once! May 21, 2026
- Chapter 1078: Pressure-resistant May 21, 2026
- Chapter 1077: Build the formation May 21, 2026
- Chapter 1076: Three flames unite May 21, 2026
- Chapter 1075: A competition of envy May 21, 2026
- Chapter 1074: The dream they once had May 21, 2026
- Chapter 1073: Old friends May 21, 2026
- Chapter 1072: Dissolve May 21, 2026
- Chapter 1071: Spreading May 21, 2026
- Chapter 1070: Dispel the Former Hatred May 21, 2026
- Chapter 1069: Poison-dipped Cold Bead May 21, 2026
- Chapter 1068: The Two Women May 21, 2026
- Chapter 1067: Holding Hostage May 21, 2026
- Chapter 1066: A Divine Crystal Mineral Lode May 21, 2026
- Chapter 1065: Divine Light May 21, 2026
- Chapter 1064: I’m Not Resigned to That! May 21, 2026
- Chapter 1063: Burn Your Hand, Feel the Heat May 21, 2026
- Chapter 1062: Really... I Didn’t do it Intentionally May 21, 2026
- Chapter 1061: I Say You Can Do it so You Can Do it! May 21, 2026
- Chapter 1060: Leona’s Spearhead! May 21, 2026
- Chapter 1059: Battling May 21, 2026
- Chapter 1058: Her Graceful Bearing May 21, 2026
- Chapter 1057: Meeting the Enemy Head-on May 21, 2026
- Chapter 1056: See the Sunlight Again May 21, 2026
- Chapter 1055: Refine the Sea May 21, 2026
- Chapter 1054: The Ones Who Cross the Border May 21, 2026
- Chapter 1053: Able to Break Any Unyielding Thing! May 21, 2026
- Chapter 1052: A Whole Entity May 21, 2026
- Chapter 1051: The Talkative Woman May 21, 2026
- Chapter 1050: Reverse in Just a Flash May 21, 2026
- Chapter 1049: The Fountainhead of Powers Upanishad May 21, 2026
- Chapter 1048: Departed Spirit Jellyfish May 21, 2026
- Chapter 1047: Poisonous Sea May 21, 2026
- Chapter 1046: Cutting space May 21, 2026
- Chapter 1045: The change of the co-soul May 21, 2026
- Chapter 1044: The remains of the Holy Beast May 21, 2026
- Chapter 1043: Shoulder the responsibility May 21, 2026
- Chapter 1042: Going Out May 21, 2026
- Chapter 1041: Ethereal Extent May 21, 2026
- Chapter 1040: Allied forces May 21, 2026
- Chapter 1039: Accumulating Energy May 21, 2026
- Chapter 1038: The Shadow Ghostly Prison is Boiling! May 21, 2026
- Chapter 1037: A Great Ruckus May 21, 2026
- Chapter 1036: The Bloody Massacre May 21, 2026
- Chapter 1035: The Perfect Shape May 21, 2026
- Chapter 1034: A Delighted Fight! May 21, 2026
- Chapter 1033: I Can Deal With Him! May 21, 2026
- Chapter 1032: That Blood Shield Again May 21, 2026
- Chapter 1031: A Bloody Battle May 21, 2026
- Chapter 1030: Protect the Territory May 21, 2026
- Chapter 1029: Crystal Eater May 21, 2026
- Chapter 1028: Renovator May 21, 2026
- Chapter 1027: Come with me! May 21, 2026
- Chapter 1026: Frantic! May 21, 2026
- Chapter 1025: Play to the gallery? May 21, 2026
- Chapter 1024: A kiss for one hundred years May 21, 2026
- Chapter 1023: You look like my lady, who has been missing fo May 21, 2026
- Chapter 1022: Caning the passionate couple? May 21, 2026
- Chapter 1021: The First Generation May 21, 2026
- Chapter 1020: Women’s Intuition May 21, 2026
- Chapter 1019: Destruction Power Upanishad May 21, 2026
- Chapter 1018: Traceable to the Same Stock May 21, 2026
- Chapter 1017: The Shocking Secrets! May 21, 2026
- Chapter 1016: Break the Ice! May 21, 2026
- Chapter 1015: We Seem to Have Some Relations May 21, 2026
- Chapter 1014: A Youngster of the Dark Clan May 21, 2026
- Chapter 1013: Proactively Kill! May 21, 2026
- Chapter 1012: Dark Shadow Clan May 21, 2026
- Chapter 1011: Shadow Ghostly Prison May 21, 2026
- Chapter 1010: When Words Get Sore, Adding More Words is Usel May 21, 2026
- Chapter 1009: The Shield has Become Heavier May 21, 2026
- Chapter 1008: Receive Help From a Savior May 21, 2026
- Chapter 1007: The Giant Blood Shield May 21, 2026
- Chapter 1006: Who Can Endure a Battle? May 21, 2026
- Chapter 1005: The Thunder God Spear May 21, 2026
- Chapter 1004: Giving Energy May 21, 2026
- Chapter 1003: Better Not to Meet May 21, 2026
- Chapter 1002: The Blood Blade Comes Out of its Sheath May 21, 2026
- Chapter 1001: Eat Meat May 21, 2026
- Chapter 1000: A Former Pursuer May 21, 2026
- Chapter 999: Crisis – Opportunity! May 21, 2026
- Chapter 998: The Third Sky of Original God Realm! May 21, 2026
- Chapter 997: Inexplicable Shock May 21, 2026
- Chapter 996: Send Them Off! May 21, 2026
- Chapter 995: Xuan Ming and Zuo Shi May 21, 2026
- Chapter 994: The Potion and Tool Pavilion’s Crisis May 21, 2026
- Chapter 993: Generous Gift! May 21, 2026
- Chapter 992: This Book? May 21, 2026
- Chapter 991: Seven Emotion and Six Desire Liquor May 21, 2026
- Chapter 990: Ancient City Battleship May 21, 2026
- Chapter 989: Travel with a Beauty May 21, 2026
- Chapter 988: Today May 21, 2026
- Chapter 987: Make the Imprint May 21, 2026
- Chapter 986: Power Upanishad in the Bloodline May 21, 2026
- Chapter 985: Blood Devil May 21, 2026
- Chapter 984: Exchange Information May 21, 2026
- Chapter 983: The Information that is Worth Ten Million May 21, 2026
- Chapter 982: Expand the Sea of Consciousness May 21, 2026
- Chapter 981: You like him? May 21, 2026
- Chapter 980: Refine Thousand Fold Lotus May 21, 2026
- Chapter 979: Immense Wealth May 21, 2026
- Chapter 978: The most distinguished guest May 21, 2026
- Chapter 977: Reunion May 21, 2026
- Chapter 976: Devil Blood Star May 21, 2026
- Chapter 975: Fu Wei May 21, 2026
- Chapter 974: Potion and Tool Pavilion May 21, 2026
- Chapter 973: Master and Servant May 21, 2026
- Chapter 972: After all, who is he? May 21, 2026
- Chapter 971: Stop there! May 21, 2026
- Chapter 970: Shi Yan’s Guarantee May 21, 2026
- Chapter 969: Ghost Hunter at This Moment May 21, 2026
- Chapter 968: Gu Mo May 21, 2026
- Chapter 967: Evil Dragon’s Natural Instincts May 21, 2026
- Chapter 966: Black Water Star May 21, 2026
- Chapter 965: Soul Refining Pool May 21, 2026
- Chapter 964: I’m sure I’ll handle it! May 21, 2026
- Chapter 963: Expel May 21, 2026
- Chapter 962: Soul changing! May 21, 2026
- Chapter 961: Inexorable doom May 21, 2026
- Chapter 960: Evil Dragon McGee May 21, 2026
- Chapter 959: Butcher the Chicken with the Cattle Knife May 21, 2026
- Chapter 958: Meddle! May 21, 2026
- Chapter 957: Three Souls May 21, 2026
- Chapter 956: Thorough Comprehension May 21, 2026
- Chapter 955: An Eccentric Man May 21, 2026
- Chapter 954: Sharpening May 21, 2026
- Chapter 953: The World of Shadows May 21, 2026
- Chapter 952: Vicious Natural Instincts May 21, 2026
- Chapter 951: Space Spider Web May 21, 2026
- Chapter 950: Inevitable Fierce Combat May 21, 2026
- Chapter 949: The Star Area Split May 21, 2026
- Chapter 948: Inheritance May 21, 2026
- Chapter 947: Death and Life Bridge May 21, 2026
- Chapter 946: Lift the Siege May 21, 2026
- Chapter 945: Revive the Deathtrap May 21, 2026
- Chapter 944: Whereabouts Disclosed May 21, 2026
- Chapter 943: Connect Two Places! May 21, 2026
- Chapter 942: Consequences of Having a Lousy Mouth May 21, 2026
- Chapter 941: It’s Dark. Please Close Your Eyes May 21, 2026
- Chapter 940: Enemies on a Narrow Road May 21, 2026
- Chapter 939: Immortal Grass May 21, 2026
- Chapter 938: Becoming Enemies May 21, 2026
- Chapter 937: Broken Star Field May 21, 2026
- Chapter 936: A Hug May 21, 2026
- Chapter 935: Opportunity May 21, 2026
- Chapter 934: Proper Arrangement May 21, 2026
- Chapter 933: Blood is Boiling! Perfect Form? May 21, 2026
- Chapter 932: Blood Replacement! May 21, 2026
- Chapter 931: Occupy All Advantages May 21, 2026
- Chapter 930: Well Played! May 21, 2026
- Chapter 929: Outsmart May 21, 2026
- Chapter 928: Open the Heart May 21, 2026
- Chapter 927: Blue Ice Jar May 21, 2026
- Chapter 926: Treasury May 21, 2026
- Chapter 925: Big Business May 21, 2026
- Chapter 924: A Reward of One Million May 21, 2026
- Chapter 923: Taboo Power May 21, 2026
- Chapter 922: Energy Divergence May 21, 2026
- Chapter 921: You’re Dead May 21, 2026
- Chapter 920: Today, I Come to Fulfill My Pledge! May 21, 2026
- Chapter 919: Blood Halberd May 21, 2026
- Chapter 918: A Long, Lonely journey May 21, 2026
- Chapter 917: Yang Tian Emperor is Well Prepared May 21, 2026
- Chapter 916: The Ransom of Seven Hundred Thousand Divine Cry May 21, 2026
- Chapter 915: Harvest May 21, 2026
- Chapter 914: The Mysterious Ancient City May 21, 2026
- Chapter 913: Fix the ancient formation May 21, 2026
- Chapter 912: Myriad Weighty Stone May 21, 2026
- Chapter 911: Thousand Fold Lotus May 21, 2026
- Chapter 910: One thousand miles underground May 21, 2026
- Chapter 909: A great migration May 21, 2026
- Chapter 908: Her News May 21, 2026
- Chapter 907: The Sole God May 21, 2026
- Chapter 906: Original God Realm! May 21, 2026
- Chapter 905: Two Souls May 21, 2026
- Chapter 904: Witness Billions of Years Pass By May 21, 2026
- Chapter 903: Seize the Origin! May 21, 2026
- Chapter 902: The Heaven Flame that Ranks First May 21, 2026
- Chapter 901: Origin May 21, 2026
- Chapter 900: Mysterious, Unrecognizable Land May 21, 2026
- Chapter 899: Immemorial Demonic Flame May 21, 2026
- Chapter 898: The Owner of the Incipient Extent May 21, 2026
- Chapter 897: An Astonishing Discovery! May 21, 2026
- Chapter 896: Bringing Hope May 21, 2026
- Chapter 895: Returned May 21, 2026
- Chapter 894: Connect to the Old Homeland May 21, 2026
- Chapter 893: A Familiar Feeling May 21, 2026
- Chapter 892: Ethereal Extent May 21, 2026
- Chapter 891: The Giant Tribe May 21, 2026
- Chapter 890: Living in Harmony May 21, 2026
- Chapter 889: The Eight Great Inheritances May 21, 2026
- Chapter 888: Are You the Tiny Beasts? May 21, 2026
- Chapter 887: Not Willing to be Mediocre May 21, 2026
- Chapter 886: Just Friends May 21, 2026
- Chapter 885: The Hollow Channel May 21, 2026
- Chapter 884: The Four-tiered Soul Altar Runs Away May 21, 2026
- Chapter 883: Struggling May 21, 2026
- Chapter 882: Thunderbolt Divine Light May 21, 2026
- Chapter 881: Awaken May 21, 2026
- Chapter 880: Summon the Divine Sword May 21, 2026
- Chapter 879: The Eccentric Smiling Face in the Stone Stele May 21, 2026
- Chapter 878: The Recoverer of the God Clan May 21, 2026
- Chapter 877: A thing of the God Clan May 21, 2026
- Chapter 876: Dark Prison Demonic Flower May 21, 2026
- Chapter 875: The demonic flower blooms May 21, 2026
- Chapter 874: We have many people here! May 21, 2026
- Chapter 873: Terrifying speculation May 21, 2026
- Chapter 872: Soul Confining Platform May 21, 2026
- Chapter 871: Follow Shi Yan! May 21, 2026
- Chapter 870: A change of heart May 21, 2026
- Chapter 869: The Remnant of Chaotic Energy May 21, 2026
- Chapter 868: Easygoing King of Heaven Hall May 21, 2026
- Chapter 867: Beseech to die May 21, 2026
- Chapter 866: Everybody Has A Chance May 21, 2026
- Chapter 865: Exchange May 21, 2026
- Chapter 864: Venom Crystallization May 21, 2026
- Chapter 863: Taking A Tonic May 21, 2026
- Chapter 862: Promise May 21, 2026
- Chapter 861: Returned To Its Rightful Owner May 21, 2026
- Chapter 860: Generous Gifts From The Deceased May 21, 2026
- Chapter 859: Intent Domain Field May 21, 2026
- Chapter 858: Inextinguishable Starlight May 21, 2026
- Chapter 857: I Think I Can Destroy You Now! May 21, 2026
- Chapter 856: The Wondrous Forbidden Land May 21, 2026
- Chapter 855: Face-to-face killing! May 21, 2026
- Chapter 854: Decided But Not Yet Pronounced Son-in-law May 21, 2026
- Chapter 853: Break the Chrysalis May 21, 2026
- Chapter 852: Shi Yan’s Face May 21, 2026
- Chapter 851: The Overcast Sky May 21, 2026
- Chapter 850: Blood Formation! May 21, 2026
- Chapter 849: Burn Your Hand, Feel the Heat May 21, 2026
- Chapter 848: I’m Sorry, I Will Choose Him May 21, 2026
- Chapter 847: A Bloody Grand Banquet May 21, 2026
- Chapter 846: The Giant Pale Hand May 21, 2026
- Chapter 845: Darkness Shrouding May 21, 2026
- Chapter 844: What Can We Do Then? May 21, 2026
- Chapter 843: The Heart of Darkness May 21, 2026
- Chapter 842: The Value Of Ten Thousand Top Quality Divine Cr May 21, 2026
- Chapter 841: Madly Striving In The Battle May 21, 2026
- Chapter 840: Dispute May 21, 2026
- Chapter 839: A Knot In The Heart May 21, 2026
- Chapter 838: The Dark Blood Sunset May 21, 2026
- Chapter 837: The Big Scarlet Shield May 21, 2026
- Chapter 836: Fusion May 21, 2026
- Chapter 835: The Mysterious Hermetic Expert May 21, 2026
- Chapter 834: The Frightful Invisible Hand May 21, 2026
- Chapter 833: Fei Lan May 21, 2026
- Chapter 832: The Mark Reappears May 21, 2026
- Chapter 831: Bet On Your Future! May 21, 2026
- Chapter 830: Zi Yaos secret bitterness May 21, 2026
- Chapter 829: Become Famous After One Battle May 21, 2026
- Chapter 828: Break The Ice To Get Out! May 21, 2026
- Chapter 827: Black Horn of the Demon Clan May 21, 2026
- Chapter 826: Monopolize! May 21, 2026
- Chapter 825: Stand Out! May 21, 2026
- Chapter 824: Can You Be More Shameless? May 21, 2026
- Chapter 823: Don’t Lean Too Close May 21, 2026
- Chapter 822: A Single Blade Attends a Banquet May 21, 2026
- Chapter 821: Conspiracy May 21, 2026
- Chapter 820: The Ring Spirits instructions May 21, 2026
- Chapter 819: Overestimated? May 21, 2026
- Chapter 818: A Battle Of Wits May 21, 2026
- Chapter 817: Rising Winds, Scudding Clouds May 21, 2026
- Chapter 816: Heaven Punishment City May 21, 2026
- Chapter 815: An Agreement May 21, 2026
- Chapter 814: Outstanding Heroes’ Uproar! May 21, 2026
- Chapter 813: Breaking Through! May 21, 2026
- Chapter 812: Meet the World Extinguishing Thunder Flame agai May 21, 2026
- Chapter 811: The Foreign Milky Way May 21, 2026
- Chapter 810: Space Riot May 21, 2026
- Chapter 809: An Old Friend Runs Into Misfortune May 21, 2026
- Chapter 808: The Blood Soul Sea May 21, 2026
- Chapter 807: Take A Part In May 21, 2026
- Chapter 806: Empty Fantasy Crystal May 21, 2026
- Chapter 805: Bloody Chief Skull Battleship May 21, 2026
- Chapter 804: A Little Mercy May 21, 2026
- Chapter 803: A Pivotal Treasure May 21, 2026
- Chapter 802: Babble On The Meteorolite May 21, 2026
- Chapter 801: A Sensual, Bloody Battle May 21, 2026
- Chapter 800: Cut Dead May 21, 2026
- Chapter 799: Bare The Fangs May 21, 2026
- Chapter 798: Star Map May 21, 2026
- Chapter 797: Undying Wood May 21, 2026
- Chapter 796: Hiding Incompetence By Keeping Quiet May 21, 2026
- Chapter 795: Small Character, Big Effect! May 21, 2026
- Chapter 794: A Dark Enchainment May 21, 2026
- Chapter 793: Meet Up In Precincts May 21, 2026
- Chapter 792: Calm Down And Break The Barriers May 21, 2026
- Chapter 791: Disappear Quietly May 21, 2026
- Chapter 790: Forbidden Area’s Wonder May 21, 2026
- Chapter 789: Deterrent Force! May 21, 2026
- Chapter 788: Break Into The Prohibited Area May 21, 2026
- Chapter 787: Counter-attack May 21, 2026
- Chapter 786: Break The Illusions! May 21, 2026
- Chapter 785: Thousand Fantasy Fields Domain May 21, 2026
- Chapter 784: The Cunning Old Fellow May 21, 2026
- Chapter 783: Wear The Domains! May 21, 2026
- Chapter 782: King God Realm! May 21, 2026
- Chapter 781: Create a Miracle! May 21, 2026
- Chapter 780: The Kings Heart May 21, 2026
- Chapter 779: A Frightening Change May 21, 2026
- Chapter 778: True Colors May 21, 2026
- Chapter 777: Getting Stronger! May 21, 2026
- Chapter 776: Pick the Tough Target to Start! May 21, 2026
- Chapter 775: Dead Sky! May 21, 2026
- Chapter 774: Rip the sky! May 21, 2026
- Chapter 773: A much valuable battle May 21, 2026
- Chapter 772: Seek battle! May 21, 2026
- Chapter 771: Leaving alone May 21, 2026
- Chapter 770: Within one hundred years, I will take the head May 21, 2026
- Chapter 769: Mutually losing face May 21, 2026
- Chapter 768: Hiding weaknesses by keeping quiet May 21, 2026
- Chapter 767: Kill a chicken with a butcher’s knife May 21, 2026
- Chapter 766: Undercurrent May 21, 2026
- Chapter 765: Purgatory Star May 21, 2026
- Chapter 764: The dawn of blood changing May 21, 2026
- Chapter 763: Demon Blood molds the body! May 21, 2026
- Chapter 762: Scarlet Mark! May 21, 2026
- Chapter 761: Dark Magnetic Deadly Explosion May 21, 2026
- Chapter 760: Convergence of the Moon’s brilliance! May 21, 2026
- Chapter 759: The Purgatory Token May 21, 2026
- Chapter 758: Heaven flame’s ascension May 21, 2026
- Chapter 757: Refine divine weapon! May 21, 2026
- Chapter 756: The best quality bone material May 21, 2026
- Chapter 755: Source of Upanishad inheritance May 21, 2026
- Chapter 754: Glorious Amethyst Star May 21, 2026
- Chapter 753: Resolutely reject May 21, 2026
- Chapter 752: Dirck May 21, 2026
- Chapter 751: Repel the enemy! May 21, 2026
- Chapter 750: Call me senior! May 21, 2026
- Chapter 749: Chaos Upanishad May 21, 2026
- Chapter 748: Soul Nirvana May 21, 2026
- Chapter 747: The Third Sky of True God Realm May 21, 2026
- Chapter 746: Power Upanishad Sublimated! May 21, 2026
- Chapter 745: Sun Original Essence! May 21, 2026
- Chapter 744: Original Magnetic Field May 21, 2026
- Chapter 743: Vermilion Bird - the Sacred Beast May 21, 2026
- Chapter 742: Compensate May 21, 2026
- Chapter 741: New comprehension! May 21, 2026
- Chapter 740: Cant choose the right way because of the flurry May 21, 2026
- Chapter 739: Volcano crystal nucleus May 21, 2026
- Chapter 738: Sun Brilliance! May 21, 2026
- Chapter 737: Outer Space God Light May 21, 2026
- Chapter 736: Do you have... mental problems? May 21, 2026
- Chapter 735: Lost May 21, 2026
- Chapter 734: Bloody Slaughterer Ka Tuo May 21, 2026
- Chapter 733: Share the hardship May 21, 2026
- Chapter 732: Zi Yao’s Promise May 21, 2026
- Chapter 731: Space Pirates May 21, 2026
- Chapter 730: The Solar Star Exploding Fragment Field May 21, 2026
- Chapter 729: Fabricate a new identity May 21, 2026
- Chapter 728: The feudal vassal admits his defeat May 21, 2026
- Chapter 727: Soul Burial Ground Deadly Upanishad! May 21, 2026
- Chapter 726: Upanishad advancement May 21, 2026
- Chapter 725: Exposed! May 21, 2026
- Chapter 724: A quota May 21, 2026
- Chapter 723: Feudal Vassal of a region May 21, 2026
- Chapter 722: A battle appointment May 21, 2026
- Chapter 721: The Moving Temporary Imperial Abode May 21, 2026
- Chapter 720: The value of Shi Yan May 21, 2026
- Chapter 719: Break the chest! May 21, 2026
- Chapter 718: Princess Zi Yao May 21, 2026
- Chapter 717: The God Domain May 21, 2026
- Chapter 716: Big business deal May 21, 2026
- Chapter 715: Raging Flame Star Area May 21, 2026
- Chapter 714: Breaking through in adversity! May 21, 2026
- Chapter 713: Shake and roam May 21, 2026
- Chapter 712: Miss Bi Rou May 21, 2026
- Chapter 711: Quenching the body to the acme May 21, 2026
- Chapter 710: Human body medicinal cauldron May 21, 2026
- Chapter 709: The Sixth Herbal Star May 21, 2026
- Chapter 708: Separate May 21, 2026
- Chapter 707: The three major God Realms May 21, 2026
- Chapter 706: Forced to exploit the ores May 21, 2026
- Chapter 705: Mining area in the foreign land May 21, 2026
- Chapter 704: The road of the vanguard May 21, 2026
- Chapter 703: Devouring Original Essence May 21, 2026
- Chapter 702: God Body? May 21, 2026
- Chapter 701: Heaven flames’ fierce battle May 21, 2026
- Chapter 700: Volunteer May 21, 2026
- Chapter 699: Meteorolite Sea May 21, 2026
- Chapter 698: Hope of dawn in the middle of the ruins May 21, 2026
- Chapter 697: Desolate deathly stillness May 21, 2026
- Chapter 696: Open May 21, 2026
- Chapter 695: Undying Demon Tribe May 21, 2026
- Chapter 694: Drawing of Lao Luo May 21, 2026
- Chapter 693: The Mark May 21, 2026
- Chapter 692: Derive the inheritance! May 21, 2026
- Chapter 691: The statues of the Demogorgon May 21, 2026
- Chapter 690: Yin Spirit Ghost Flame May 21, 2026
- Chapter 689: The Second Demon Area May 21, 2026
- Chapter 688: Ancient Desolate Area, Border Sea May 21, 2026
- Chapter 687: Put down May 21, 2026
- Chapter 686: True God Realm May 21, 2026
- Chapter 685: The Three-tiered Soul Sacrificial Altar May 21, 2026
- Chapter 684: The Seal of Upanishad of the lasting mark May 21, 2026
- Chapter 683: Advance together May 21, 2026
- Chapter 682: A new world! May 21, 2026
- Chapter 681: That’s how we work! May 21, 2026
- Chapter 680: Demon Testing Needle May 21, 2026
- Chapter 679: Drink May 21, 2026
- Chapter 678: Soul fragments May 21, 2026
- Chapter 677: Another entrance of the Secret Domain May 21, 2026
- Chapter 676: Destiny pronounces your sentence May 21, 2026
- Chapter 675: Marvelous law May 21, 2026
- Chapter 674: I don’t need them! May 21, 2026
- Chapter 673: Hundreds of flowers blossom May 21, 2026
- Chapter 672: We believe in Old Long! May 21, 2026
- Chapter 671: Behead! May 21, 2026
- Chapter 670: Engulf! May 21, 2026
- Chapter 669: Changes in earth and heaven! May 21, 2026
- Chapter 668: Hit until she vomits the pellets! May 21, 2026
- Chapter 667: Purgatory of heart May 21, 2026
- Chapter 666: The Utmost Eight May 21, 2026
- Chapter 665: Naked provocation! May 21, 2026
- Chapter 664: Change the structure! May 21, 2026
- Chapter 663: Leave the rest to me May 21, 2026
- Chapter 662: Five Elements Primitive Realm May 21, 2026
- Chapter 661: The perpetual light that never extinguishes! May 21, 2026
- Chapter 660: Offer sacrifices to the divine weapon! May 21, 2026
- Chapter 659: Headshot! May 21, 2026
- Chapter 658: Then we fight! May 21, 2026
- Chapter 657: Inextricable! May 21, 2026
- Chapter 656: Qi Tian Odie May 21, 2026
- Chapter 655: No way back! May 21, 2026
- Chapter 654: Master Acceptance Ceremony May 21, 2026
- Chapter 653: Wind and clouds move! May 21, 2026
- Chapter 652: I’m the Master! May 21, 2026
- Chapter 651: Dispel visitors May 21, 2026
- Chapter 650: Construct the city walls May 21, 2026
- Chapter 649: A beam of hope for dawn May 21, 2026
- Chapter 648: Deep affection – Generous love May 21, 2026
- Chapter 647: Impasse? May 21, 2026
- Chapter 646: No return! May 21, 2026
- Chapter 645: Contact the foreign land May 21, 2026
- Chapter 644: Corpse Clans Soul Sacrificial Altar May 21, 2026
- Chapter 643: King of Perpetual Night Forest May 21, 2026
- Chapter 642: Upgrade the whole body! May 21, 2026
- Chapter 641: Parting ways May 21, 2026
- Chapter 640: Demon Clan? God Clan? May 21, 2026
- Chapter 639: Repercussion May 21, 2026
- Chapter 638: Negative field! May 21, 2026
- Chapter 637: Tit for tat! May 21, 2026
- Chapter 636: Fierce man! May 21, 2026
- Chapter 635: Yang Tian Emperor gets crazy! May 21, 2026
- Chapter 634: Mind perception May 21, 2026
- Chapter 633: Apprehend May 21, 2026
- Chapter 632: Wicked genius! May 21, 2026
- Chapter 631: Fire and Ice Secret Domain May 21, 2026
- Chapter 630: The Creator’s Divine Pond! May 21, 2026
- Chapter 629: Everyone takes a step back May 21, 2026
- Chapter 628: Kill him! May 21, 2026
- Chapter 627: If we want to do it, leave no room for maneuver May 21, 2026
- Chapter 626: The Star Original Essence May 21, 2026
- Chapter 625: Mirror Lake May 21, 2026
- Chapter 624: Breaking rules! May 21, 2026
- Chapter 623: Demonic beast sheds the mortal skin May 21, 2026
- Chapter 622: Good friendship May 21, 2026
- Chapter 621: Befriend Monsters May 21, 2026
- Chapter 620: New situation! May 21, 2026
- Chapter 619: Frantically great refining! May 21, 2026
- Chapter 618: Later happiness? May 21, 2026
- Chapter 617: Rupture May 21, 2026
- Chapter 616: Run counter May 21, 2026
- Chapter 615: I have something to say! May 21, 2026
- Chapter 614: Change May 21, 2026
- Chapter 613: Blood animosity May 21, 2026
- Chapter 612: Ancient Mark May 21, 2026
- Chapter 611: The Ancient ‘Bao’ (Cruel) Family May 21, 2026
- Chapter 610: Bao Ao May 21, 2026
- Chapter 609: Opportunity May 21, 2026
- Chapter 608: Ringleader May 21, 2026
- Chapter 607: Catastrophe May 21, 2026
- Chapter 606: Separate May 21, 2026
- Chapter 605: Underworld God Sacrifice May 21, 2026
- Chapter 604: Dark Sea overflows May 21, 2026
- Chapter 603: The Race Catastrophe May 21, 2026
- Chapter 602: Ghost Hunter breaks through! May 21, 2026
- Chapter 601: Refining secret treasures May 21, 2026
- Chapter 600: Golden Marrow May 21, 2026
- Chapter 599: Wash the soul May 21, 2026
- Chapter 598: The Gold Giant May 21, 2026
- Chapter 597: Heaven Flame Divine Refining Technique! May 21, 2026
- Chapter 596: Corpse Clan May 21, 2026
- Chapter 595: Refining corpses May 21, 2026
- Chapter 594: Legend May 21, 2026
- Chapter 593: Changing May 21, 2026
- Chapter 592: Apprehending May 21, 2026
- Chapter 591: Mediocre! May 21, 2026
- Chapter 590: Aftermath May 21, 2026
- Chapter 589: Burn the soul! May 21, 2026
- Chapter 588: Cracks in the blue dome of heaven! May 21, 2026
- Chapter 587: Bitter struggle May 21, 2026
- Chapter 586: Overdrawing May 21, 2026
- Chapter 585: Molting! May 21, 2026
- Chapter 584: Immortal body! May 21, 2026
- Chapter 583: Fate fusion May 21, 2026
- Chapter 582: Shake the God! May 21, 2026
- Chapter 581: Fierce battle May 21, 2026
- Chapter 580: Counter-attack! May 21, 2026
- Chapter 579: Instigating May 21, 2026
- Chapter 578: Divine Weapon! May 21, 2026
- Chapter 577: Ten Antiquity Clans May 21, 2026
- Chapter 576: Touching May 21, 2026
- Chapter 575: Earth Forbidden Technique May 21, 2026
- Chapter 574: Exceptionally envious May 21, 2026
- Chapter 573: Seven-leaflet Soul Cutting Grass May 21, 2026
- Chapter 572: Sky Destroyer May 21, 2026
- Chapter 571: Push through shoving and bumping May 21, 2026
- Chapter 570: The Ancient Cave Mansion May 21, 2026
- Chapter 569: Unforeseen event arises May 21, 2026
- Chapter 568: The Subterranean World May 21, 2026
- Chapter 567: Shady Firmament Old Mound May 21, 2026
- Chapter 566: Heaven Thunder Beast May 21, 2026
- Chapter 565: Wonderful Stone City May 21, 2026
- Chapter 564: Fusing light energy! May 21, 2026
- Chapter 563: Big Dipper God Arrow May 21, 2026
- Chapter 562: Evil reputation May 21, 2026
- Chapter 561: Wide gap May 21, 2026
- Chapter 560: Agreed May 21, 2026
- Chapter 559: Exposed May 21, 2026
- Chapter 558: Radiant God Cult’s Master May 21, 2026
- Chapter 557: Spirit Realm! May 21, 2026
- Chapter 556: Virescent soul sea May 21, 2026
- Chapter 555: Space changes! May 21, 2026
- Chapter 554: Dark Spirit Clan May 21, 2026
- Chapter 553: Repair rare treasures May 21, 2026
- Chapter 552: Self-torture May 21, 2026
- Chapter 551: Blood Pupils May 21, 2026
- Chapter 550: Force meets force! May 21, 2026
- Chapter 549: If its a must fight, then fight! May 21, 2026
- Chapter 548: The second battle! May 21, 2026
- Chapter 547: Comprehend May 21, 2026
- Chapter 546: One strike to rout May 21, 2026
- Chapter 545: Cousin? May 21, 2026
- Chapter 544: Provoking May 21, 2026
- Chapter 543: Calamity May 21, 2026
- Chapter 542: Evil wind turbulence May 21, 2026
- Chapter 541: Waste more effort May 21, 2026
- Chapter 540: Soul Dividing May 21, 2026
- Chapter 539: Great changes are approaching May 21, 2026
- Chapter 538: She’s really great May 21, 2026
- Chapter 537: Li Zheng Rong May 21, 2026
- Chapter 536: Unhurriedly enter the mountain May 21, 2026
- Chapter 535: Precipitous May 21, 2026
- Chapter 534: Gigolo? May 21, 2026
- Chapter 533: Hunting dead souls May 21, 2026
- Chapter 532: Awakening May 21, 2026
- Chapter 531: Spirit Hall May 21, 2026
- Chapter 530: The Alchemists’ Center May 21, 2026
- Chapter 529: Dead Soul Mountain May 21, 2026
- Chapter 528: Hidden danger May 21, 2026
- Chapter 527: Bathe in the brilliant sunlight May 21, 2026
- Chapter 526: Powerful purification May 21, 2026
- Chapter 525: Self-reliance May 21, 2026
- Chapter 524: Desperate! May 21, 2026
- Chapter 523: Seven-colored Poison Technique May 21, 2026
- Chapter 522: Icebound earth and firmament May 21, 2026
- Chapter 521: Tender aroma May 21, 2026
- Chapter 520: Understand tacitly May 21, 2026
- Chapter 519: Strong-bonded sisterhood May 21, 2026
- Chapter 518: Join Soul May 21, 2026
- Chapter 517: Unlock Bloodline May 21, 2026
- Chapter 516: Try to be flexible May 21, 2026
- Chapter 515: I was also virgin ~~~ May 21, 2026
- Chapter 514: One to resist three May 21, 2026
- Chapter 513: The Third Sky of Sky Realm! May 21, 2026
- Chapter 512: The withering death May 21, 2026
- Chapter 511: Frequency of Murderous skills May 21, 2026
- Chapter 510: Vanish Mind Smoke May 21, 2026
- Chapter 509: Put forth! May 21, 2026
- Chapter 508: Good root, good fruits May 21, 2026
- Chapter 507: All kinds of flowers bloom May 21, 2026
- Chapter 506: Leading the wolf into the house May 21, 2026
- Chapter 505: A humiliating condition May 21, 2026
- Chapter 504: The Decline of the Family May 21, 2026
- Chapter 503: Gold God Blood May 21, 2026
- Chapter 502: Showing Goodwill May 21, 2026
- Chapter 501: A tetrad together to compute perfection May 21, 2026
- Chapter 500: Ice, Chill, Cold, and Frost May 21, 2026
- Chapter 499: Surpass the limit! May 21, 2026
- Chapter 498: Ice Emperor City May 21, 2026
- Chapter 497: Two sisters of a blended family May 21, 2026
- Chapter 496: Retrieve May 21, 2026
- Chapter 495: Two beautiful sisters May 21, 2026
- Chapter 494: The coldest place May 21, 2026
- Chapter 493: Pay the favor with the body? May 21, 2026
- Chapter 492: Proper arrangement May 21, 2026
- Chapter 491: Sweep away! May 21, 2026
- Chapter 490: Visit the old place May 21, 2026
- Chapter 489: New legend! May 21, 2026
- Chapter 488: We’ll do as you say May 21, 2026
- Chapter 487: Master? May 21, 2026
- Chapter 486: Spoils of War May 21, 2026
- Chapter 485: Determine firmament and earth! May 21, 2026
- Chapter 484: Yang Tian Emperor May 21, 2026
- Chapter 483: Cao Qiu Dao May 21, 2026
- Chapter 482: Wind and clouds discolor May 21, 2026
- Chapter 481: Corpse Mount, Corpse Sea May 21, 2026
- Chapter 480: Showing remarkable ability May 21, 2026
- Chapter 479: Fulfill expectations May 21, 2026
- Chapter 478: Those upholding justice will find help everywhe May 21, 2026
- Chapter 477: Exposing May 21, 2026
- Chapter 476: Strong Wind May 21, 2026
- Chapter 475: Final decision May 21, 2026
- Chapter 474: Boldness May 21, 2026
- Chapter 473: Imposing May 21, 2026
- Chapter 472: Strong Crowd May 21, 2026
- Chapter 471: Rip in half! May 21, 2026
- Chapter 470: Come out! May 21, 2026
- Chapter 469: The War Devil May 21, 2026
- Chapter 468: Awaken May 21, 2026
- Chapter 467: Remaining might May 21, 2026
- Chapter 466: Second Sky of Sky Realm May 21, 2026
- Chapter 465: Vicious Qi overflows firmament May 21, 2026
- Chapter 464: Look, you are not strong enough! May 21, 2026
- Chapter 463: Safely Free May 21, 2026
- Chapter 462: Shi Yan from the Yang Family! May 21, 2026
- Chapter 461: The Sea Races’ Banquet May 21, 2026
- Chapter 460: Silver Stone Fort May 21, 2026
- Chapter 459: Entourage of Eight May 21, 2026
- Chapter 458: See clearly May 21, 2026
- Chapter 457: Famous reputation spreads far and wide May 21, 2026
- Chapter 456: The strongest warrior! May 21, 2026
- Chapter 455: Top Dog May 21, 2026
- Chapter 454: First time doing blacksmith job! May 21, 2026
- Chapter 453: Memory transmission May 21, 2026
- Chapter 452: Pacifying May 21, 2026
- Chapter 451: Rich Blacksmith Resources May 21, 2026
- Chapter 450: Wild Schemes May 21, 2026
- Chapter 449: The Matriarch of the Naga Tribe May 21, 2026
- Chapter 448: Force you to give in! May 21, 2026
- Chapter 447: Must change! May 21, 2026
- Chapter 446: Arch the eyebrow May 21, 2026
- Chapter 445: Attention May 21, 2026
- Chapter 444: Domineering May 21, 2026
- Chapter 443: It was good to have you here May 21, 2026
- Chapter 442: Reversal May 21, 2026
- Chapter 441: Bloody Repression May 21, 2026
- Chapter 440: Enter the stage! May 21, 2026
- Chapter 439: Strong wine grows murderous spirit May 21, 2026
- Chapter 438: All forces join hands May 21, 2026
- Chapter 437: The most difficult time comes May 21, 2026
- Chapter 436: A turn for the better? Shi Yan? May 21, 2026
- Chapter 435: Changes of Temperature in human emotions May 21, 2026
- Chapter 434: I like a woman who smiles at me! May 21, 2026
- Chapter 433: The Naga Tribe May 21, 2026
- Chapter 432: Seabed May 21, 2026
- Chapter 431: Shi Yan’s influence May 21, 2026
- Chapter 430: Tear the mask May 21, 2026
- Chapter 429: The Dark Dwellers May 21, 2026
- Chapter 428: The Return Journey May 21, 2026
- Chapter 427: Farewell May 21, 2026
- Chapter 426: The God Blood’s magical effects May 21, 2026
- Chapter 425: Exchange May 21, 2026
- Chapter 424: Promise May 21, 2026
- Chapter 423: Kill them all! May 21, 2026
- Chapter 422: King of Demonic Insects May 21, 2026
- Chapter 421: Surging tide mind May 21, 2026
- Chapter 420: Take it on May 21, 2026
- Chapter 419: Life Original Fluid May 21, 2026
- Chapter 418: Corpse-eating Demonic Insect May 21, 2026
- Chapter 417: The swamp’s terrifying changes May 21, 2026
- Chapter 416: Spin Cocoon May 21, 2026
- Chapter 415: Submitted May 21, 2026
- Chapter 414: Slap on the face May 21, 2026
- Chapter 413: The heart with a grudge May 21, 2026
- Chapter 412: Swallow hollow spirits May 21, 2026
- Chapter 411: Sentimental Selection May 21, 2026
- Chapter 410: The abnormal underground May 21, 2026
- Chapter 409: Nine types of Heaven Flames May 21, 2026
- Chapter 408: Restore the original shape May 21, 2026
- Chapter 407: Blacksmith Secret of Success May 21, 2026
- Chapter 406: The Mysterious Gate May 21, 2026
- Chapter 405: Sky Realm May 21, 2026
- Chapter 404: Hit to deform it! May 21, 2026
- Chapter 403: Diamond Martial Spirit May 21, 2026
- Chapter 402: Mistaken May 21, 2026
- Chapter 401: Rampage May 21, 2026
- Chapter 400: Out of control May 21, 2026
- Chapter 399: Lending a helping hand May 21, 2026
- Chapter 398: The Northern Dipper Arrows May 21, 2026
- Chapter 397: Viciousness May 21, 2026
- Chapter 396: Mountain and River Seal May 21, 2026
- Chapter 395: A moment of gasping for breath May 21, 2026
- Chapter 394: The Insight battle May 21, 2026
- Chapter 393: Defeated May 21, 2026
- Chapter 392: Give me a position! May 21, 2026
- Chapter 391: Brutal killing May 21, 2026
- Chapter 390: Fearless May 21, 2026
- Chapter 389: I Know Them May 21, 2026
- Chapter 388: Beasts’ roars May 21, 2026
- Chapter 387: Seven ancient factions May 21, 2026
- Chapter 386: The Galaxy, the ancient corpses, and the secret May 21, 2026
- Chapter 385: Arrival May 21, 2026
- Chapter 384: New understanding May 21, 2026
- Chapter 383: Conception May 21, 2026
- Chapter 382: I will call the shots from now on May 21, 2026
- Chapter 381: Insight May 21, 2026
- Chapter 380: Turn the tide May 21, 2026
- Chapter 379: Faded Astral Wind May 21, 2026
- Chapter 378: Reaping May 21, 2026
- Chapter 377: Add wings to the tiger! May 21, 2026
- Chapter 376: Filled with golden silk threads May 21, 2026
- Chapter 375: The hunter May 21, 2026
- Chapter 374: Coming Ashore May 21, 2026
- Chapter 373: Punishment May 21, 2026
- Chapter 372: Occupying the beauty May 21, 2026
- Chapter 371: Bursting Attack May 21, 2026
- Chapter 370: Underwater beauty May 21, 2026
- Chapter 369: The Lake May 21, 2026
- Chapter 368: Hiding real competence May 21, 2026
- Chapter 367: The God Soul Secret Treasure May 21, 2026
- Chapter 366: Pathfinder May 21, 2026
- Chapter 365: Beasts, dangerous traps, and humans May 21, 2026
- Chapter 364: Virtue and Evil May 21, 2026
- Chapter 363: Three males and two females May 21, 2026
- Chapter 362: The Strange Land May 21, 2026
- Chapter 361: Top-class warriors May 21, 2026
- Chapter 360: The Northern Dipper Net May 21, 2026
- Chapter 359: Tell her that I am still alive May 21, 2026
- Chapter 358: Blessing and peril linked together May 21, 2026
- Chapter 357: Fame of brutality May 21, 2026
- Chapter 356: Looking forward to your growth May 21, 2026
- Chapter 355: I give you freedom May 21, 2026
- Chapter 354: Frenzy May 21, 2026
- Chapter 353: An ambush in adversity May 21, 2026
- Chapter 352: Using malicious tricks to hurt a woman May 21, 2026
- Chapter 351: Seeking wealth from danger May 21, 2026
- Chapter 350: My way May 21, 2026
- Chapter 349: Mentality change May 21, 2026
- Chapter 348: Mutating again May 21, 2026
- Chapter 347: Slaughter May 21, 2026
- Chapter 346: Star Wings May 21, 2026
- Chapter 345: Open the inheritance May 21, 2026
- Chapter 344: Chapter 342: Stars Gathering power May 21, 2026
- Chapter 343: Miracle May 21, 2026
- Chapter 342: The Sun God, Moon God, and Star Gods appeared a May 21, 2026
- Chapter 341: Presumptuous May 21, 2026
- Chapter 340: Lord of the future May 21, 2026
- Chapter 339: Sword breaks the void May 21, 2026
- Chapter 338: A complete fusion May 21, 2026
- Chapter 337: Chapter 335: Crossing arms and doing nothing May 21, 2026
- Chapter 336: Suicide break May 21, 2026
- Chapter 335: Craziness May 21, 2026
- Chapter 334: Separating in life, parting in death May 21, 2026
- Chapter 333: A big defeat May 21, 2026
- Chapter 332: ChiYan May 21, 2026
- Chapter 331: Using an ox-cleaver to carve a chicken May 21, 2026
- Chapter 330: Devil clouds engulfing the sky May 21, 2026
- Chapter 329: Regardless of consequences May 21, 2026
- Chapter 328: Brazen intimidation May 21, 2026
- Chapter 327: On the edge of life and death May 21, 2026
- Chapter 326: Heading to the Mountain Peak May 21, 2026
- Chapter 325: Regain the trust May 21, 2026
- Chapter 324: The strong right arm May 21, 2026
- Chapter 323: Stay with you May 21, 2026
- Chapter 322: Understanding people’s heart May 21, 2026
- Chapter 321: The Mutant Martial Spirit May 21, 2026
- Chapter 320: Investigating May 21, 2026
- Chapter 319: Possessed by Devil May 21, 2026
- Chapter 318: Understandable May 21, 2026
- Chapter 317: The covenant May 21, 2026
- Chapter 316: Hidden matters May 21, 2026
- Chapter 315: Dark Magnetic Noxious Mist May 21, 2026
- Chapter 314: Three Antiquities May 21, 2026
- Chapter 313: The Soul Bridge May 21, 2026
- Chapter 312: Not the one who is content with staying in pond May 21, 2026
- Chapter 311: You understand my ass! May 21, 2026
- Chapter 310: Violent attacks May 21, 2026
- Chapter 309: Aggressively fighting May 21, 2026
- Chapter 308: Eyes of Love May 21, 2026
- Chapter 307: Dare to come here and play with me in the water May 21, 2026
- Chapter 306: Good fortune came unexpectedly May 21, 2026
- Chapter 305: Joint owner May 21, 2026
- Chapter 304: The King Corpse made a roar May 21, 2026
- Chapter 303: The Superb Adjoin Corpses Flame May 21, 2026
- Chapter 302: Understood May 21, 2026
- Chapter 301: Showing the real ability May 21, 2026
- Chapter 300: You cant go May 21, 2026
- Chapter 299: Long time no see May 21, 2026
- Chapter 298: Great Sun Holy Light Tian Mu May 21, 2026
- Chapter 297: The Sun Island May 21, 2026
- Chapter 296: Captives May 21, 2026
- Chapter 295: Its not because of you May 21, 2026
- Chapter 294: Soul Confrontation May 21, 2026
- Chapter 293: Spiritual Qi Bullets May 21, 2026
- Chapter 292: Holy Spirit God May 21, 2026
- Chapter 291: Looking at each other from a space distance May 21, 2026
- Chapter 290: Dragon Horn Clan - Ma Qi Jie May 21, 2026
- Chapter 289: Shi Yan’s request May 21, 2026
- Chapter 288: The invitation of the Three Gods Sect May 21, 2026
- Chapter 287: The Declaration of Love May 21, 2026
- Chapter 286: Strong May 21, 2026
- Chapter 285: Confrontation May 21, 2026
- Chapter 284: Visitors May 21, 2026
- Chapter 283 - The Peak Earth Realm May 21, 2026
- Chapter 282 - Determination May 21, 2026
- Chapter 281: Listening to the Earths movements May 21, 2026
- Chapter 280 - Awaiting the Emperor May 21, 2026
- Chapter 277 - Rooting May 21, 2026
- Chapter 276 - The big picture May 21, 2026
- Chapter 275 - Who are you after all? May 21, 2026
- Chapter 274 - The Kele Clan May 21, 2026
- Chapter 273 - Spirit Gear inside the Flying Shuttle May 21, 2026
- Chapter 272 - Snow Dragon Island May 21, 2026
- Chapter 271 - The path to return (the way home) May 21, 2026
- Chapter 270 - Make you my Master May 21, 2026
- Chapter 269 - Confine it! May 21, 2026
- Chapter 268 - The Great Destruction May 21, 2026
- Chapter 267 - I can help you May 21, 2026
- Chapter 266 - Peculiar treasure appeared May 21, 2026
- Chapter 265 - The Nine Serenities Soul Devouring Flame May 21, 2026
- Chapter 264 - Breaking the shelter May 21, 2026
- Chapter 263 - Watch me! May 21, 2026
- Chapter 262 - Intimidating Heavenly Prestigious Power May 21, 2026
- Chapter 261 - Ruthless May 21, 2026
- Chapter 260 - Didn’t consider them humans May 21, 2026
- Chapter 259 - Mercy May 21, 2026
- Chapter 258 - Hunting May 21, 2026
- Chapter 257 - The younger generation who surpassed the older May 21, 2026
- Chapter 256 - Raving waves May 21, 2026
- Chapter 255 - Soul perception May 21, 2026
- Chapter 254 - Unexpected cake from Heaven May 21, 2026
- Chapter 253 - Desire wealth in Shiger May 21, 2026
- Chapter 252 - God’s Will May 21, 2026
- Chapter 251 - Arrogant Bluster May 21, 2026
- Chapter 250 - What is there to be scared of? May 21, 2026
- Chapter 249 - Transformation of the sea of consciousness May 21, 2026
- Chapter 248 - Casually Response May 21, 2026
- Chapter 247 - Bad things turned out to be good May 21, 2026
- Chapter 246 - History repeated May 21, 2026
- Chapter 245 - He is very special May 21, 2026
- Chapter 244 - Five Devils Condensation Refining May 21, 2026
- Chapter 243 - Give me a reason May 21, 2026
- Chapter 242 - Totally wiped out May 21, 2026
- Chapter 241 - Birdman May 21, 2026
- Chapter 240 - Everything has its conqueror May 21, 2026
- Chapter 239 - The Sound Beast Mountain May 21, 2026
- Chapter 238 - Demonic Sound Clan May 21, 2026
- Chapter 237 - Gigantic stone Castle May 21, 2026
- Chapter 238 - Absorption May 21, 2026
- Chapter 237 - An extraordinary treasure May 21, 2026
- Chapter 236: The Sun Refined Spirit May 21, 2026
- Chapter 235: Today was better than before May 21, 2026
- Chapter 234: Defeat you May 21, 2026
- Chapter 233: I Can Kill Them! May 21, 2026
- Chapter 232 - The Earth Realm May 21, 2026
- Chapter 231 - Breakthrough May 21, 2026
- Chapter 230 - Lost May 21, 2026
- Chapter 229 - Counter-attack May 21, 2026
- Chapter 228 - Turn the Tide May 21, 2026
- Chapter 227 - You Really Surprised Me! May 21, 2026
- Chapter 226 - You Guys Go First! May 21, 2026
- Chapter 225 - Ambush May 21, 2026
- Chapter 224 - Meteor Array May 21, 2026
- Chapter 223 - The Chasm Battlefield May 21, 2026
- Chapter 222 - Famous May 21, 2026
- Chapter 221 - Peak of the Disaster Realm May 21, 2026
- Chapter 220 - There is no need to be so direct, right ? May 21, 2026
- Chapter 219 - So Lame! May 21, 2026
- Chapter 218 - The Demon Ghost Showed its viciousness May 21, 2026
- Chapter 217 - The Power Rankings May 21, 2026
- Chapter 216 - Sky-breaking Shuttle May 21, 2026
- Chapter 215 - Three choices May 21, 2026
- Chapter 214 - We Belong Together! May 21, 2026
- Chapter 213 - The Ancient Gate of Heaven May 21, 2026
- Chapter 212 - The Change May 21, 2026
- Chapter 211 - Beast Ghost May 21, 2026
- Chapter 210 - You’re really something May 21, 2026
- Chapter 209 - Formed the Consciousness Sea May 21, 2026
- Chapter 208 - Magic Effects of Divine Blood May 21, 2026
- Chapter 207 - Ancient Divine Blood May 21, 2026
- Chapter 206 - I Bet! May 21, 2026
- Chapter 205 - The Yang Family’s Challenge May 21, 2026
- Chapter 204 - The Yang Family May 21, 2026
- Chapter 203 - Arrival May 21, 2026
- Chapter 202 - Destroy the Mountain May 21, 2026
- Chapter 201 - I’m Your Elder Brother! May 21, 2026
- Chapter 200 - Seven Magical Shifts May 21, 2026
- Chapter 199 - Rampage May 21, 2026
- Chapter 198 - Insight the danger May 21, 2026
- Chapter 197 - It’s My Turn! May 21, 2026
- Chapter 196 - The Spotlight Turned May 21, 2026
- Chapter 195 - Harsh Enemy May 21, 2026
- Chapter 194 - Now You Are convinced May 21, 2026
- Chapter 193 - Thriller May 21, 2026
- Chapter 192 - The Shadow at Dark Night May 21, 2026
- Chapter 191 - Black Scale Tribe May 21, 2026
- Chapter 190 - The invasion of Demon Dwellers May 21, 2026
- Chapter 189 - Exit May 21, 2026
- Chapter 188 - Evolution of twin martial spirits May 21, 2026
- Chapter 187 - Refinement May 21, 2026
- Chapter 186 - Extreme refining May 21, 2026
- Chapter 185 - The gift from Ice Cold Flame May 21, 2026
- Chapter 184 - Approve May 21, 2026
- Chapter 183 - The Heart of the Volcano May 21, 2026
- Chapter 182 - Under the Flames May 21, 2026
- Chapter 181 - Winning and Losing Are Very Important May 21, 2026
- Chapter 180 - Depends on My Mood May 21, 2026
- Chapter 179 - I’ll Bet With You! May 21, 2026
- Chapter 178 - Wanna Bet? May 21, 2026
- Chapter 177 - Firecloud Island May 21, 2026
- Chapter 176 - Exactly How Strong? May 21, 2026
- Chapter 175 - Didn’t Come for Nothing! May 21, 2026
- Chapter 174 - Misunderstanding May 21, 2026
- Chapter 173 - The Beauty Fell Asleep May 21, 2026
- Chapter 172 - The Demon King was Alarmed May 21, 2026
- Chapter 171 - The Royalty Level Secret Treasure May 21, 2026
- Chapter 170 - Got it! May 21, 2026
- Chapter 169 - Octagon Demon Formation May 21, 2026
- Chapter 168 - Demon Master Mojito May 21, 2026
- Chapter 167 - Every Minute Counts May 21, 2026
- Chapter 166 - Cultivating a Fake Soul! May 21, 2026
- Chapter 165 - Scheming With Demon Dwellers May 21, 2026
- Chapter 164 - Promise May 21, 2026
- Chapter 163 - Soul Gathering Beast May 21, 2026
- Chapter 162 - Extort a Confession May 21, 2026
- Chapter 161 - I will be waiting for you! Always! May 21, 2026
- Chapter 160 - Soul Gathering Pool May 21, 2026
- Chapter 159 - Upgrade the Treasure May 21, 2026
- Chapter 158 - Deterrence May 21, 2026
- Chapter 157 - A Pleasant Journey May 21, 2026
- Chapter 156 - I like obedient women May 21, 2026
- Chapter 155 - I will save you! May 21, 2026
- Chapter 154 - Kill May 21, 2026
- Chapter 153 - Speak Out May 21, 2026
- Chapter 152 - Forging Secret Treasures May 21, 2026
- Chapter 151 - Got it Wrong? May 21, 2026
- Chapter 150 - UnderseaBattle May 21, 2026
- Chapter 149 - Soul Attack May 21, 2026
- Chapter 148 - Expert? May 21, 2026
- Chapter 147 - Hardship May 21, 2026
- Chapter 146 - Lying Low May 21, 2026
- Chapter 145 - Saved May 21, 2026
- Chapter 144 - Sealed in Ice for Three Years May 21, 2026
- Chapter 143 - Immortal Island May 21, 2026
- Chapter 142 - Seize the Body May 21, 2026
- Chapter 141 - The Iceberg Seals the Island May 21, 2026
- Chapter 140 - Sky Fire May 21, 2026
- Chapter 139 - Site-clearing May 21, 2026
- Chapter 138 - Fusion May 21, 2026
- Chapter 137 - Upheaval May 21, 2026
- Chapter 136 - Breaking the Constraint May 21, 2026
- Chapter 135 - Tip of the Iceberg May 21, 2026
- Chapter 134 - The Hengluo Sea May 21, 2026
- Chapter 133 - The Countercharge May 21, 2026
- Chapter 132 - The Slaughter of the Island May 21, 2026
- Chapter 131 - Controlling the corpses May 21, 2026
- Chapter 130 - The Mutation of Life and Death May 21, 2026
- Chapter 129 - Two Sky Corpses May 21, 2026
- Chapter 128 - Live on! May 21, 2026
- Chapter 127 - The Burial Site May 21, 2026
- Chapter 126 - The Second Sky of Rampage! May 21, 2026
- Chapter 125 - Accept as Disciple? May 21, 2026
- Chapter 124 - Here, On This Ship, You Are My Girl! May 21, 2026
- Chapter 123 - One Palace, Two Divine Lands, Three Wonderland May 21, 2026
- Chapter 122 - The Yin Yang Wonderland May 21, 2026
- Chapter 121 - A Man and A Woman Alone May 21, 2026
- Chapter 120 - Crossing the Sea with a Beauty May 21, 2026
- Chapter 119 - The Devil King Bo Xun May 21, 2026
- Chapter 118 - The Goddess of the Moon May 21, 2026
- Chapter 117 - The Change of the God Stone May 21, 2026
- Chapter 116 - Let Him Watch Closely! May 21, 2026
- Chapter 115 - Kill Everything! May 21, 2026
- Chapter 114 - Shi Tie’s Death May 21, 2026
- Chapter 113 - Poisonous Bu Bo May 21, 2026
- Chapter 112 - Human Realm Third Sky! May 21, 2026
- Chapter 111 - Immortal pills May 21, 2026
- Chapter 110 - You Don’t Deserve That! May 21, 2026
- Chapter 109 - The Shura King May 21, 2026
- Chapter 108 - Waiting for an Opportunity May 21, 2026
- Chapter 107 - Strong Aid May 21, 2026
- Chapter 106 - God Child May 21, 2026
- Chapter 105 - The Star Martial Spirit May 21, 2026
- Chapter 104 - Great Disaster May 21, 2026
- Chapter 103 - The Space Collapses May 21, 2026
- Chapter 102 - Nothing to Do With Me! May 21, 2026
- Chapter 101 - Identity Exposed May 21, 2026
- Chapter 100 - Endure! May 21, 2026
- Chapter 99 - But, I Want to Kill You! May 21, 2026
- Chapter 98 - Fattened Up May 21, 2026
- Chapter 97 - Grind! May 21, 2026
- Chapter 96 - Kill All the Way! May 21, 2026
- Chapter 95 - Desperate Fight May 21, 2026
- Chapter 94 - I’ll Go! May 21, 2026
- Chapter 93 - The God Search Skill May 21, 2026
- Chapter 92 - The Gate of Heaven Appears May 21, 2026
- Chapter 91 - Dividing the Plunder May 21, 2026
- Chapter 90 - The Sky Changes May 21, 2026
- Chapter 89 - Forming the Yin Pearls May 21, 2026
- Chapter 88 - Strange Scene May 21, 2026
- Chapter 87 - Black Formula May 21, 2026
- Chapter 86 - The Yin Field May 21, 2026
- Chapter 85 - A Co-Master May 21, 2026
- Chapter 84 - The Dead Swamp May 21, 2026
- Chapter 83 - Meeting Face to Face May 21, 2026
- Chapter 82 - A Step Further May 21, 2026
- Chapter 81 - Obsession May 21, 2026
- Chapter 80 - Shadowing May 21, 2026
- Chapter 79 - The Seal of Life and Death May 21, 2026
- Chapter 78 - Inheritance of the War Devil May 21, 2026
- Chapter 77 - Pounding Energy May 21, 2026
- Chapter 76 - Exquisite Figure May 21, 2026
- Chapter 75 - A Kiss May 21, 2026
- Chapter 74 - Taken Care Of! May 21, 2026
- Chapter 73 - The Change in the Fallen God Stone May 21, 2026
- Chapter 72 - Each With Their Own Schemes May 21, 2026
- Chapter 71 - Take Advantage of Their Weakness!! May 21, 2026
- Chapter 70 - The Focus of Attention May 21, 2026
- Chapter 69 - Believe in Me! May 21, 2026
- Chapter 68 - A Thorough Defeat May 21, 2026
- Chapter 67 - The Battle Among the Families May 21, 2026
- Chapter 66 - Fearless May 21, 2026
- Chapter 65 - Undercurrent May 21, 2026
- Chapter 64 - The Medicine King, Mu Xun May 21, 2026
- Chapter 63 - The Martial Competition May 21, 2026
- Chapter 62 - Unrecognized May 21, 2026
- Chapter 61 - Leaders of the Third Generation May 21, 2026
- Chapter 60 - The Endless Sea May 21, 2026
- Chapter 59 - The Situation Surges May 21, 2026
- Chapter 58 - The Plot May 21, 2026
- Chapter 57 - In My Hands! May 21, 2026
- Chapter 56 - Basalt Scriptures and the Dragon Turtle Armor May 21, 2026
- Chapter 55 - The Weirdo May 21, 2026
- Chapter 54 - Zuo Shi May 21, 2026
- Chapter 53 - Visitors from the Zuo Family May 21, 2026
- Chapter 52 - The Mysterious Area May 21, 2026
- Chapter 51 - The Martial Spirit Palace May 21, 2026
- Chapter 50 - A Cut May 21, 2026
- Chapter 49 - The Sky Gate and the God Area May 21, 2026
- Chapter 48 - The Test May 21, 2026
- Chapter 47 - Tianyun City May 21, 2026
- Chapter 46 - A Glance May 21, 2026
- Chapter 45 - The Change May 21, 2026
- Chapter 44 - Silent Town May 21, 2026
- Chapter 43 - Beiming Family May 21, 2026
- Chapter 42 - Departure May 21, 2026
- Chapter 41 - The Third Sky of Nascent Level May 21, 2026
- Chapter 40 - Sharing the Treasure May 21, 2026
- Chapter 39 - Three types of Flames May 21, 2026
- Chapter 38 - Spirit Level Martial Skills May 21, 2026
- Chapter 37 - The Killing May 21, 2026
- Chapter 36 - Bang! May 21, 2026
- Chapter 35 - Block the Cave May 21, 2026
- Chapter 34 - Mysterious Martial Spirit May 21, 2026
- Chapter 33 - Martial Spirit of Music May 21, 2026
- Chapter 32 - The Silver Thunder Wolf May 21, 2026
- Chapter 31 - Blue Magic Flames May 21, 2026
- Chapter 30 - Inside the Tree May 21, 2026
- Chapter 29 - Eating Human Flesh May 21, 2026
- Chapter 28 - The Blast May 21, 2026
- Chapter 27: The Three Parties Unite May 21, 2026
- Chapter 26 - The Wager May 21, 2026
- Chapter 25 - Ghost May 21, 2026
- Chapter 24 - Trouble May 21, 2026
- Chapter 23 - The Tush Mercenary Union May 21, 2026
- Chapter 22 - Shi Family May 21, 2026
- Chapter 21 - Pervert May 21, 2026
- Chapter 20 - Steel Himself May 21, 2026
- Chapter 19 - The Martial Spirit of Petrifaction May 21, 2026
- Chapter 18 - Being pursued May 21, 2026
- Chapter 17 - Ten Times of Gravity May 21, 2026
- Chapter 16 - Treasure May 21, 2026
- Chapter 15 - Promoting to Nascent-Level Warrior May 21, 2026
- Chapter 14 - Music from the Heaven May 21, 2026
- Chapter 13 - Surprise Kill May 21, 2026
- Chapter 12 - The Mysterious Martial Skill in the Blood Vein May 21, 2026
- Chapter 11 - Strike Back May 21, 2026
- Chapter 10 - Drag Her Down May 21, 2026
- Chapter 9 - The Escape May 21, 2026
- Chapter 8 - The Jade Blade Spider May 21, 2026
- Chapter 7 - The Second Sky May 21, 2026
- Chapter 6 - Immortal Martial Spirit May 21, 2026
- Chapter 5 - Lightning Martial Spirit May 21, 2026
- Chapter 4 - Guinea Pig May 21, 2026
- Chapter 3 - First encounter May 21, 2026
- Chapter 2 - The Body Remodelled May 21, 2026
- Chapter 1 - Reborn In Another World May 21, 2026
Reviews
0 comments