Font Size
15px

The Spirits of Void and Chaos were the bane of realms.

The legends of Spirit Realm even said that even galaxies could perish if a Spirit of Void and Chaos was allowed to grow.

The Spirits of Void and Chaos could consume any natural energy that matched their element. Once they entered rank ten, just being at a realm that shared its element would result in the latter being consumed by it.

The fire spirit had successfully evolved to rank nine after forcefully transforming land of his own in Flaming Sun Purgatory into its own element.

In fact, the day it entered rank ten wasn’t too far away.

On its own, it wouldn’t be easy for the fire spirit to consume the Molten Rock Purgatory’s fire. It was still at rank nine.

However, Qin Lie’s Perfect Blood had the bloodline of Spirits of Void and Chaos in it.

Moreover, Qin Lie had the fire spirit’s bloodline ability, flame consumption. Now that he was a Great Lord of the Abyss, he had the power to unleash its full potential.

Him being the master of the fire spirit allowed the fire spirit to use flame consumption on Molten Rock Purgatory despite being a rank lower.

“Whoosh whoosh whoosh!”

With the fire spirit at the center, the burning hole started absorbing all of Molten Rock Purgatory’s flames.

While cooperating with the fire spirit, Qin Lie narrowed his eyes and quietly checked how the ability was doing. He discovered that the bloodline ability was actually damaging the fundamental laws of Molten Rock Purgatory!

It was unbelievable!

“Rumble!”

Flames streamed into the hole like crazy.

The ground of Molten Rock Purgatory kept falling apart. The rivers and lakes of lava were slowly drying up.

Even the eternally red sky of Molten Rock Purgatory was suddenly marred by several new spatial rifts. Huge amounts of fire energy was leaking out of these spatial rifts!

All of this was happening because of Qin Lie and the fire spirit’s flame consumption. It damaged Molten Rock Purgatory’s laws directly and stole its power for themselves!

At the same time.

A flaming hole suddenly appeared on the firmament of Flaming Sun Purgatory. More specifically, it had appeared on the land of the fire spirit.

A rich amount of fire energy and lava was pouring through that hole.

“This is!”

The rank ten Vermillion Bird, Tong Yan, leaped off the mouth of her volcano and took to the sky. She was in her original form.

She could sense tremendous amounts of fire energy pouring through the fiery passage.

It wasn't just her either. Every Vermillion Bird and living being that cultivated the power of fire was rejoicing.

The Vermillion Bird Realm was the root and foundation of the fire spirit’s domain. The fire spirit had to convert a huge amount of abyss devil energy into fire energy and spread them across the land of Flaming Sun Purgatory to form its domain.

Right now, the deep ravines of the fire spirit’s domain were being injected with boiling lava.

This molten lava originally belonged to Molten Rock Purgatory. However, Qin Lie and the fire spirit had successfully drawn it over to Flaming Sun Purgatory instead!

Flaming Sun Purgatory was clearly stealing the power of Molten Rock Purgatory!

Meanwhile, the culprit behind it all, Qin Lie, was hovering in the sky of Molten Rock Purgatory. He could sense his power and his understanding of the laws of fire growing rapidly with each passing second.

He knew that it was all due to the bloodline ability flame consumption!

On the other side, the Devil Monarch of Molten Rock Purgatory could sense his own purgatory spiralling out of his control clearly.

His influence over Molten Rock Purgatory was diminishing because of the foreign being at the center of that flaming hole, the fire spirit of Void and Chaos.

Molten Rock Purgatory was losing energy rapidly, and the world itself was falling apart. Both his power and his domain were out of his control.

“Amazing!”

“He’s damaging the heart of Molten Rock Purgatory directly!”

“The Molten Rock Monarch is in for a treat!”

The six Devil Monarchs were going to interfere with the fight, but they stopped when they sensed what was happening to Molten Rock Purgatory.

They closed their eyes and perceived their surroundings with their powerful souls and knowledge of the laws of the Abyss.

Soon, they discovered that Molten Rock Purgatory was shrinking slowly. Flaming Sun Purgatory on the other hand, was growing bigger!

They were all monarchs of an Abyss Purgatory, but Qin Lie somehow had the ability to affect another Devil Monarch’s purgatory directly!

It was an unimaginable feat!

All Great Lords of the Abyss could create a domain that best suited them when they reached rank ten.

Naturally, the Great Lords of the Abyss were at their strongest inside their own domain.

Molten Rock Purgatory was something the Molten Rock Monarch had created slowly through his study of the laws of fire.

One might say that this purgatory was his unique domain, except that it was a million times bigger than normal!

His own purgatory was the best place for him to fight in. He should have the ability to suppress any Great Lord of the Abyss at his level pletely!

Even the other Devil Monarchs thought that Qin Lie would be pletely helpless after he was dragged into Molten Rock Purgatory.

Reality had greatly defied their expectations, however!

“Impossible! You, you can damage Molten Rock Purgatory’s fundamental laws directly? Impossible!” the Molten Rock Monarch roared.

Suddenly, the life crystal flew out of his grip before he realized it.

“Whoosh!”

It was as if the Flame Devil King's life crystal was attracted by the flaming hole created by Qin Lie and the fire spirit.

The Flame Devil King's life crystal vanished into the hole in an instant.

Inside the Flaming Sun Purgatory, Tong Yan was surprised when the burning meteor that had protected the Vermillion Bird Realm for many years suddenly appeared in the sky.

“Swhoosh!”

The giant rock sank into the Vermillion Bird Realm’s ancestral ground once more—the heart of the volcano!

“King of Flame Devils!”

The Molten Rock Monarch could do nothing but watch the burning meteor escape his grasp.

All the while, his Molten Rock Purgatory was growing worse and worse. Volcanoes were crumbling all over the place.

Thousands of spatial rifts had appeared in the dark red sky as well. Even more fire energy was slipping out of Molten Rock Purgatory.

“No!” the Molten Rock Monarch screamed in despair.

“Qin Lie! That’s enough!” Auston shouted.

“Flaming Sun Monarch! You can stop now!” the Ghost Sacrificial Monarch also said urgently. “You’ve taught the Molten Rock Monarch a lesson, regained the Flame Devil King's life crystal, and stole Molten Rock Purgatory’s core energy. You’ve already been pensated! If you keep this up, Molten Rock Purgatory may crumble into nothing, and he won’t be a Devil Monarch anymore! Stability is the most important thing right now. We don’t need more Great Lords of the Abyss slaughtering each other to bee the new Devil Monarch!”

“Please stop! We all acknowledge your right as a Devil Monarch!” the Plague Monarch yelled.

“Enough!”

After Qin Lie had had the absolute upper hand, the six great Devil Monarchs hurriedly told Qin Lie to stop.

Right now, Qin Lie was still executing flame consumption” and destroying Molten Rock Purgatory.

Molten Rock Purgatory was the root of Molten Rock Monarch’s status and power. If it was destroyed, he wouldn’t be a Devil Monarch any longer.

If he was eliminated from their ranks, the Great Lords of the upper hundred Abyss levels would definitely fight like hell to bee the Devil Monarch. It would send the entire Abyss into a long period of turmoil and unrest.

This was something no one wanted to see.

“Alright, I’ll give you all face this time,” Qin Lie said with a cold snort before finally stopping.

You are reading Spirit Realm Chapter 1781: Plundering! on novel69. Use the chapter navigation above or below to continue reading the latest translated chapters.
Share with your friends
Library saves books to your account. Reading History saves recent chapters in this browser.
Continuous reading

You may also like

The Purgatory Calamity cover
Same author

The Purgatory Calamity

Ni Cang Tian ·Eastern

TheyoungPangJianwasforcedtoascendtotheheavens. …… ps:ThisisNiCangtian’snewworkafter“GodOfSlaughter”and“SpiritRealm”. Source:Webnovel.com,updatedonN...

God of Slaughter cover
Same author

God of Slaughter

Ni Cang Tian ·Action

Growingupparentless,ShiYan,whowasleftwithalargeinheritancemoney,boreageneraldisinterestinlife. Theonlytimeshefeltalivewaswhenadrenalinecoursedthoro...

Slime True Immortal cover
Similar genre

Slime True Immortal

肚子有点胀 ·Fantasy

Spring—aseasonofrenewalandrebirth.Intheswampforest,magicalbeastswerebeginningtostir.Onthereed-linedriverbanks,beastkinsharpenedsticksandsettraps,ly...

No reviews yet. Be the first reader to leave one.
Please create an account or sign in to post a comment.