Font Size
15px

Chapter 1500: Soul Sensing Art

Ji Family’s private room.

Qin Lie’s Soul Beast avatar immediately started transforming after both his true body and his Soul Beast avatar were led into the room.

A tremendous amount of soul energy was spread as the Soul Beast returned to its original form.

“Whoosh!”

At the same time, Qin Lie’s Soul Race subsoul—a Soul Tree—emerged from the Soul Beast’s giant head while swaying slowly.

After that, Qin Lie tapped himself once in the glabella, and the Soul Suppressing Orb slowly emerged and flew to the top of his head.

Qin Lie’s powerful soul presence filled up the giant private room like a tidal wave.

At a corner of the room, Ji Yuan stared at Qin Lie’s Soul Suppressing Orb and his subsoul curiously.

“The Soul Race’s holy artifact and a soul in the shape of a Soul Tree… Is this a Soul Race clansman’s true form?”

Ji Yuan was very curious. She discovered that the Qin Lie in front of her was very different from the Qin Lie she used to know.

As a member of the Ji Family and Miao Yizi’s best friend, the previous “Qin Lie” wasn’t unfamiliar to her.

She knew what the old Qin Lie had done to Miao Yizi. She also knew that Qin Lie’s reckless actions had ultimately resulted in Qin Family’s departure from Spirit Realm.

Ji Yuan had partial control over the Ji Family’s intelligence department. Naturally, she was aware that Qin Lie had gone to Rock Calamity Domain and captured a certain Han Family woman.

“He really is different now…” she muttered to herself.

The Soul Suppressing Orb floating above Qin Lie’s head slowly moved closer towards the Soul Tree.

It hovered right around the Soul Tree’s root area.

“Swoosh swoosh swoosh!”

Suddenly, gray soul threads flew out of the Soul Tree’s roots and entangled around the Soul Suppressing Orb.

Then, the Soul Tree tried searching for the Soul Race clansmen using the Soul Race’s secret art.

“Soul Sensing Art!”

A ripple of invisible light that could only be detected by the soul spread out from the Soul Suppressing Orb.

An instant later, the mysterious light had spread across the entire Ji Family territory!

Countless light dots suddenly appeared inside the Soul Suppressing Orb’s first space. Every light dot represented a single soul.

At this moment, he was able to detect any lifeform with a soul within the search area, no matter who or what they were.

He injected a wisp of his soul into the Soul Suppressing Orb.

It almost looked like the first level of the Soul Suppressing Orb had transformed into a bright galaxy full of stars.

He knew that every star in this “galaxy” represented a soul and a life.

Among them, he spotted dozens of light dots with tiny soul marks in them...

His true body’s eyes lit up at the discovery.

The Soul Tree continued to unleash more and more gray soul threads.

Qin Lie was injecting even more soul energy into the Soul Suppressing Orb.

After his rank ten Soul Beast avatar, its rank ten soulline and its tremendous soul energy had formed a steady link with the Soul Suppressing Orb, the Soul Sensing Art’s range continued to increase.

“Sky Mender Palace.”

With a single thought, every soul in Sky Mender Palace’s territory appeared inside the Soul Suppressing Orb in succession.

Even more light dots appeared inside the Soul Suppressing Orb’s first space. Every light dot still represented a single soul.

However, Qin Lie couldn’t find a single soul slave among the millions of light dots.

“They’re not at Sky Mender Palace…”

He changed the direction of his Soul Sensing Art again and approached the Ao Family.

The river of stars representing Sky Mender Palace turned dim and vanished.

It meant that he had withdrawn his senses from Sky Mender Palace.

A whole new river of stars started replacing the old ones.

These ones represented the souls in the Ao Family.

Unlike last time, Qin Lie could spot a hundred or so souls with soul marks among the millions of light dots.

This meant that there were at least a hundred or so soul servants still existing inside the Ao Family’s territory.

Next, Qin Lie spread out part of the soul perception he was using to scan the Ji Family towards the Lu Family.

“Boom!”

A fierce, violent, bloodthirsty and insane soul aura suddenly entered his view.

It was a Soul Tree residing within the river of light that represented the Lu Family!

Most of the light dots surrounding the Soul Trees were imprinted with a soul mark!

Qin Lie instantly realized that the Soul Race clansman who had moved on from the Ao Family to the Lu Family was still there! The illusory Soul Tree was none other than that tyrannical Soul Race clansman!

Naturally, the light dots with soul marks in them near the Soul Tree were all his soul servants!

“Bang!”

Suddenly, the river of light representing the Lu Family exploded and became incredibly unstable.

“Mind your own business!”

A brutal and tyrannical soul message suddenly burst forth from inside the light river.

Qin Lie was immediately jolted out of his meditative state.

His forehead was covered in sweat.

“How are you doing?” Ji Yuan asked with concern.

Qin Lie shook his head and sucked in a deep breath. “I’m fine.”

He closed his eyes once more and cut off the soul perception he had over the Ji Family, Sky Mender Palace, the Ao Family, and the Lu Family.

He directed his attention towards a new target, Starry Hall.

Millions of light dots appeared inside the Soul Suppressing Orb once more.

Another Soul Tree appeared amidst the light dots.

Just like before, there were a lot of light dots with soul marks in them inside the Soul Tree.

“Since you’ve returned alive, I will not attack the Ji Family, Sky Mender Palace, or the Qin Family any longer. I will only be attacking your enemy, the six great forces. I hope you won’t interfere and make trouble for us!”

Another soul message had been transmitted from the Soul Tree and straight into his soul.

After that, the light dots around the Soul Trees—those that didn’t have a soul mark in them—started extinguishing one after another.

Qin Lie hadn’t yet withdrawn his Soul Sensing Art.

He knew what the extinguishing light dots meant—the Soul Race clansman at Starry Hall was slaughtering the people there!

Every extinguishing light dot represented a life that was being devoured by that Soul Race clansman!

Wearing a dark look on his face, Qin Lie finally canceled the Soul Sensing Art and opened his eyes fully.

He then pointed at the Soul Suppressing Orb and had it enter his glabella once more.

This time, he didn’t rely on his rank ten subsoul to perceive his surroundings. He used his own soul to perform a short range scan instead.

“Let’s go out.” He got up to his feet and walked outside.

Ji Yuan looked at him in confusion. “So? What is going on?”

“There are a dozen or so soul servants in the Ji Family’s ancestral grounds right now. We should eliminate them first,” Qin Lie said.

“You found them?” Ji Yuan exclaimed in pleasant surprise.

Qin Lie nodded in response.

Excited beyond words, Ji Yuan opened the door and led him outside once more.

Outside the room, the Ice Emperor, Ji Dan and Hua Tianqiong were all waiting for him with solemn expressions.

They shot him a hopeful look in unison when they saw him emerging with Ji Yuan.

“He hasn’t gone to Sky Mender Palace.” Qin Lie pondered for a moment before continuing. “He knows that my true body has returned to Spirit Realm, so he went straight to Starry Hall instead. In fact, he’s attacking their people right now.”

The news pleasantly surprised the group before their expressions suddenly turned plicated.

“All is fine as long as he’s no longer hiding in the Ji Family!” Hua Tianqiong chuckled.

“If we can find him, then we will be able to deal with him!” Ji Dan said coldly.

“Starry Hall is a part of the human race as well. Much of the people he killed are innocent civilians too.” The Ice Emperor sighed.

“There are still some soul servants left behind in the Ji Family territory. They probably hadn’t left yet because that Soul Race clansman thought that Narsen would be able to take me out of the picture,” Qin Lie said seriously. “I’ll give you some coordinates. Let’s take out these soul servants first before anything else!”

“Alright!” Ji Dan said.

“Bang!”

Somewhere far away, a Nirvana Realm martial practitioner who was walking inside the city suddenly lost his head and collapsed.

A dozen or so martial practitioners had suddenly exploded and died all over the city as well.

“No, never mind.” Qin Lie suddenly stopped them with an odd look. “He killed all of them for us.”

“What?” Ji Yuan exclaimed.

“My true body had returned, and I’d found out exactly where he was. He knew that there was no longer any point keeping these soul servants around.” Qin Lie inhaled once before continuing. “We were going to kill all of his soul servants anyway, so he did us a favor and used his soul mark to crush all those poor souls into bits.”

Everyone’s expression changed in an instant.

Qin Lie remained silent for a moment before he finally continued. “He had promised me not to attack the Ji Family, Sky Mender Palace, or the Qin Family. He’ll only attack the six great forces if I mind my own business and stay out of his way.”

You are reading Spirit Realm Chapter 1500: Soul Sensing Art on novel69. Use the chapter navigation above or below to continue reading the latest translated chapters.
Share with your friends
Library saves books to your account. Reading History saves recent chapters in this browser.
Continuous reading

You may also like

The Purgatory Calamity cover
Same author

The Purgatory Calamity

Ni Cang Tian ·Eastern

TheyoungPangJianwasforcedtoascendtotheheavens. …… ps:ThisisNiCangtian’snewworkafter“GodOfSlaughter”and“SpiritRealm”. Source:Webnovel.com,updatedonN...

God of Slaughter cover
Same author

God of Slaughter

Ni Cang Tian ·Action

Growingupparentless,ShiYan,whowasleftwithalargeinheritancemoney,boreageneraldisinterestinlife. Theonlytimeshefeltalivewaswhenadrenalinecoursedthoro...

Slime True Immortal cover
Similar genre

Slime True Immortal

肚子有点胀 ·Fantasy

Spring—aseasonofrenewalandrebirth.Intheswampforest,magicalbeastswerebeginningtostir.Onthereed-linedriverbanks,beastkinsharpenedsticksandsettraps,ly...

No reviews yet. Be the first reader to leave one.
Please create an account or sign in to post a comment.