Synopsis
Lucifer,anordinaryorphanboywhowasbroughtupbyawealthyfamilytobetheplaymateoftheirdaughter.That'showthingshavebeenuntilonenight,whenhegotattackbysomethingunnatural,thatwasthenighttheworldchangedforhim.p.sThisworldisgoingtobedark,lotsofkillings,alotofr18contents,mostnoteveninvolvingtheMC,alsoMcisnotgoingtotakeallthegirlshecomesacross,hewillhavefemalefriendshewillmakealongtheway,therewillbeYuricontentsandlotsmore,butActionsprevailsthemall.
Readers Also Like
Primordial Villain with a Slave Harem
Quinlan,asimpleofficeworkerfindshimselftransmigratedtoanextremelydangerousfantasylandasalevel1Commonerwithnothingtohisnamebuthi...
Demonic Pornstar System
Divingintodungeons,slayingmonsters,and…filmingporn? Whenthemanaapocalypsestruck,15%ofhumanityawakenedsupernaturalabilities,beco...
The Strongest Urban Son-in-law
ThenameoftheWarGodmustnotbeinsulted!Thenation'sinterestsmustnotbeviolated!Myfriendsandfamilymustnotbebullied!TheinvincibleWarGo...
Zombie Bodyguard
Whosaidzombiesarestiff-limbedandfearthesunlight?Afterbecomingazombie,LinTianwasimpervioustobladesandbullets,andcouldmovefreelya...
The Ace Bigshot Becomes A Farmgirl
ShuYutransmigratedtobecomeamobcharacter,exiledintooblivionafterappearingtwiceafterhelpingthefemalesidecharacterwhokepttryingtod...
Legend of Dragon Son-in-law
NeverhadtheJordfamilyexpectedtheirson-in-law,aloserintheireyes,tobethehiddenDragonLordwhohadlivedformyriadsofyears…
Chapters 899
- Chapter 929: Fearmongering Ladies Aug 11, 2026
- Chapter 928: Done Aug 11, 2026
- Chapter 927: The Hidden Hand Aug 10, 2026
- Chapter 926: Exit Interview Aug 09, 2026
- Chapter 925: Racist Big Sis Aug 09, 2026
- Chapter 924: Overwhelming Difference Aug 08, 2026
- Chapter 923: Greatly Desired Aug 08, 2026
- Chapter 922: Falling Value Aug 07, 2026
- Chapter 921: Unsettling Rumors Aug 07, 2026
- Chapter 920: Rumors Aug 07, 2026
- Chapter 919: New Batch Aug 06, 2026
- Chapter 918: Winning Aug 06, 2026
- Chapter 917: Definitely-Not-Yuna’s Masterplan Aug 06, 2026
- Chapter 916: Victory Condition Aug 05, 2026
- Chapter 915: A Simple Test Aug 04, 2026
- Chapter 914: Job Interview Aug 04, 2026
- Chapter 913: Yuna Park Aug 02, 2026
- Chapter 912: Pet Merch Aug 02, 2026
- Chapter 911: Misguided Aug 01, 2026
- Chapter 910: Mistake Aug 01, 2026
- Chapter 909: Making Big Moves Jul 31, 2026
- Chapter 908: Balance in Red Jul 31, 2026
- Chapter 907: A Guild Master’s Dilemmas Jul 30, 2026
- Chapter 906: Should I? Jul 30, 2026
- Chapter 905: Road Home Jul 29, 2026
- Chapter 904: New Classification Jul 29, 2026
- Chapter 903: Association Announcement Jul 28, 2026
- Chapter 902: Listening In Jul 28, 2026
- Chapter 901: Break Room Jul 28, 2026
- Chapter 900: A Freak Accident Jul 26, 2026
- Chapter 899: F-Tier Jul 26, 2026
- Chapter 898: Watched Jul 25, 2026
- Chapter 897: Tear in Reality Jul 24, 2026
- Chapter 896: Not To Be Outdone Jul 24, 2026
- Chapter 895: Devastating Class Manifestations Jul 24, 2026
- Chapter 894: Procedure Gone Wrong Jul 24, 2026
- Chapter 893: New Awakened Evaluation Jul 24, 2026
- Chapter 892: Power Plays Jul 24, 2026
- Chapter 891: Stark Difference Jul 24, 2026
- Chapter 890: Big Day Jul 24, 2026
- Chapter 889: Lazy Morning Jul 24, 2026
- Chapter 888: Paragon of Sin and his Moon Jul 24, 2026
- Chapter 887: At War Jul 24, 2026
- Chapter 886: Retiring for the Night Jul 24, 2026
- Chapter 885: Challenged Egos Jul 24, 2026
- Chapter 884: Overeager Doggy Jul 24, 2026
- Chapter 883: New Kink Unlocked Jul 24, 2026
- Chapter 882: The Construction Begins Jul 24, 2026
- Chapter 881: Vespera’s Present Jul 24, 2026
- Chapter 880: Answering the Questions of the World Jul 24, 2026
- Chapter 879: Soren and Mabel Jul 24, 2026
- Chapter 878: Happy Mom Jul 24, 2026
- Chapter 877: Strict Mother Jul 24, 2026
- Chapter 876: Final Hope Jul 24, 2026
- Chapter 875: Commitment Jul 24, 2026
- Chapter 874: Legality Jul 24, 2026
- Chapter 873: Hope Jul 24, 2026
- Chapter 872: Charitable Kaiden Jul 24, 2026
- Chapter 871: Different Approach Jul 24, 2026
- Chapter 840: Match Begin Jun 24, 2026
- Chapter 839: Detention Jun 24, 2026
- Chapter 838: Little Ladies Jun 24, 2026
- Chapter 837: The Gambit Jun 24, 2026
- Chapter 836: Fourth Valkyrie Jun 24, 2026
- Chapter 835: Resolute Girl Jun 24, 2026
- Chapter 834: Open Spot Jun 24, 2026
- Chapter 833: Transferred Inheritance Jun 24, 2026
- Chapter 832: Mission Complete Jun 24, 2026
- Chapter 831: Grand Finale Jun 24, 2026
- Chapter 830: Not a Softie Jun 24, 2026
- Chapter 829: Assisted Cowgirl Jun 24, 2026
- Chapter 828: Sneaky Fox Jun 24, 2026
- Chapter 827: Chaotic Tent Jun 24, 2026
- Chapter 826: Support Jun 24, 2026
- Chapter 825: Art Jun 24, 2026
- Chapter 824: Lost in Lust Jun 24, 2026
- Chapter 823: Fighting Jun 24, 2026
- Chapter 822: Small-Chested But Proud! Jun 24, 2026
- Chapter 821: Pampered Jun 24, 2026
- Chapter 820: Furious Moon Jun 24, 2026
- Chapter 819: Into the Bedroom Jun 24, 2026
- Chapter 818: Speed Blitzing to Rank 4! Jun 24, 2026
- Chapter 817: New Plan Jun 24, 2026
- Chapter 816: Retreating Enemies Jun 24, 2026
- Chapter 815: Confused Jun 24, 2026
- Chapter 814: Combat Drift Jun 08, 2026
- Chapter 813: Supportive Little Sister Jun 08, 2026
- Chapter 812: Flow State Jun 07, 2026
- Chapter 811: Going to War Jun 07, 2026
- Chapter 810: Ruinwalkers Jun 05, 2026
- Chapter 809: Mommy’s Boy Jun 05, 2026
- Chapter 808: Spitting Balloon Jun 03, 2026
- Chapter 807: Ashborn Trio in Action Jun 03, 2026
- Chapter 806: Dilemma Jun 03, 2026
- Chapter 805: Magma Eater Jun 03, 2026
- Chapter 804: Disaster May 31, 2026
- Chapter 803: New Powers May 31, 2026
- Chapter 802: Badass Girls May 31, 2026
- Chapter 801: Hunger May 31, 2026
- Chapter 800: Dissatisfied Anomalies May 28, 2026
- Chapter 799: One Percent May 28, 2026
- Chapter 798: Roar of Challenge May 27, 2026
- Chapter 797: Probing Wave May 27, 2026
- Chapter 796: Manly Dream May 26, 2026
- Chapter 795: Stranded Outside May 25, 2026
- Chapter 794: Counter Strategy May 25, 2026
- Chapter 793: The Siege Begins May 24, 2026
- Chapter 792: Sin Fusion May 23, 2026
- Chapter 791: Rapidly Growing Numbers May 22, 2026
- Chapter 790: Skyward May 22, 2026
- Chapter 789: Savoring May 22, 2026
- Chapter 788: Final Countdown May 21, 2026
- Chapter 787: Last Arrivals May 21, 2026
- Chapter 786: Final Hour May 20, 2026
- Chapter 785: Creation Mode May 20, 2026
- Chapter 784: Lacking Gratitude May 20, 2026
- Chapter 783: Unexpected Newcomer May 20, 2026
- Chapter 782: Third Phase of the Apocalypse May 20, 2026
- Chapter 781: Investing Strat May 20, 2026
- Chapter 780: Evolving the Army May 20, 2026
- Chapter 779: New Upgrades May 20, 2026
- Chapter 778: Champions May 20, 2026
- Chapter 777: Fangirl Mode May 20, 2026
- Chapter 776: Ascending May 20, 2026
- Chapter 775: Size Issues May 20, 2026
- Chapter 774: Back in the Dungeon May 20, 2026
- Chapter 773: Challenge May 20, 2026
- Chapter 772: Usurper May 20, 2026
- Chapter 771: Living Mountain May 20, 2026
- Chapter 770: Final Day May 20, 2026
- Chapter 769: Massive Leap May 20, 2026
- Chapter 768: Morning Afterglow May 20, 2026
- Chapter 767: Lovey-Dovey 18 May 20, 2026
- Chapter 766: Dream Come True 18 May 20, 2026
- Chapter 765: Surprise 18 May 20, 2026
- Chapter 764: Men, Out May 20, 2026
- Chapter 763: Chaotic Dinner May 20, 2026
- Chapter 762: No Dinner May 20, 2026
- Chapter 761: Scary Stream May 20, 2026
- Chapter 760: New Meta May 20, 2026
- Chapter 759: Divine Light May 20, 2026
- Chapter 758: Eclipse’s First Hunt May 20, 2026
- Chapter 757: Stream Start May 20, 2026
- Chapter 756: Fangirls United May 20, 2026
- Chapter 755: Unexpected Call May 20, 2026
- Chapter 754: Guild Leader Ashborn May 20, 2026
- Chapter 753: Rewarded Loyalty May 20, 2026
- Chapter 752: Eclipse May 20, 2026
- Chapter 751: Delusion May 20, 2026
- Chapter 750: Finishing Blow May 20, 2026
- Chapter 749: Pitch May 20, 2026
- Chapter 748: Thoroughly Researched May 20, 2026
- Chapter 747: Twin Producers May 20, 2026
- Chapter 746: Kira and Rika May 20, 2026
- Chapter 745: Clan Leader May 20, 2026
- Chapter 744: Vespera’s Decision May 20, 2026
- Chapter 743: The Architect May 20, 2026
- Chapter 742: Sworn Fealty May 20, 2026
- Chapter 741: Impossible Distance May 20, 2026
- Chapter 740: Hissing Kitty May 20, 2026
- Chapter 739: Aaaaand Cut! May 20, 2026
- Chapter 738: Crushing New Reality May 20, 2026
- Chapter 737: In Her Trap May 20, 2026
- Chapter 736: Served Cold May 20, 2026
- Chapter 735: Natasha Volkov May 20, 2026
- Chapter 734: A Strange Donation May 20, 2026
- Chapter 733: Betrayal May 20, 2026
- Chapter 732: The Truth May 20, 2026
- Chapter 731: Best Moderator May 20, 2026
- Chapter 730: No More Darkness May 20, 2026
- Chapter 729: Live May 20, 2026
- Chapter 728: Confused Fangirls May 20, 2026
- Chapter 727: Terms of Dissolution May 20, 2026
- Chapter 726: Incompetence May 20, 2026
- Chapter 725: Refusal to Disappoint May 20, 2026
- Chapter 724: Futile May 20, 2026
- Chapter 723: Hideous Things May 20, 2026
- Chapter 722: Fury May 20, 2026
- Chapter 721: Consumed May 20, 2026
- Chapter 720: Demon of Wrath May 20, 2026
- Chapter 719: Bait May 20, 2026
- Chapter 718: Revenge May 20, 2026
- Chapter 717: A Strange Feeling May 20, 2026
- Chapter 716: Accelerating Curve May 20, 2026
- Chapter 715: Brewing Problems May 20, 2026
- Chapter 714: A Professional Relationship May 20, 2026
- Chapter 713: Moonlit Sex 18 May 20, 2026
- Chapter 712: Deal Secured May 20, 2026
- Chapter 711: Cold Space Babe May 20, 2026
- Chapter 710: Big Dummies May 20, 2026
- Chapter 709: Win-Win May 20, 2026
- Chapter 708: Nyx’s Revenge May 20, 2026
- Chapter 707: Illegal Statements May 20, 2026
- Chapter 706: Lies! May 20, 2026
- Chapter 705: Used and Abused May 20, 2026
- Chapter 704: Executive Meeting May 20, 2026
- Chapter 703: Lowest Point May 20, 2026
- Chapter 702: Dead End May 20, 2026
- Chapter 701: Moonlight May 20, 2026
- Chapter 700: Trapped May 20, 2026
- Chapter 699: Regret May 20, 2026
- Chapter 698: Kaiden’s Promise May 20, 2026
- Chapter 697: Cherished Siblings May 20, 2026
- Chapter 696: He Is Ashborn May 20, 2026
- Chapter 695: Alone Time May 20, 2026
- Chapter 694: Point Changes May 20, 2026
- Chapter 693: Reunited May 20, 2026
- Chapter 692: Malice May 20, 2026
- Chapter 691: It’s Done May 20, 2026
- Chapter 690: Advice May 20, 2026
- Chapter 689: Admiration May 20, 2026
- Chapter 688: Questioned May 20, 2026
- Chapter 687: Standoff May 20, 2026
- Chapter 686: Crumbling Composure May 20, 2026
- Chapter 685: Fury May 20, 2026
- Chapter 684: They Chose This May 20, 2026
- Chapter 683: No Longer Innocent May 20, 2026
- Chapter 682: Online May 20, 2026
- Chapter 681: Death Wish May 20, 2026
- Chapter 680: Spiteful Fangirls May 20, 2026
- Chapter 679: My Beautiful Angels May 20, 2026
- Chapter 678: Back to Kai’s Arms May 20, 2026
- Chapter 677: Sorry, I Tried! May 20, 2026
- Chapter 676: Luna, Hunt May 20, 2026
- Chapter 675: New Plan May 20, 2026
- Chapter 674: Pattern May 20, 2026
- Chapter 673: New Target May 20, 2026
- Chapter 672: Two Options May 20, 2026
- Chapter 671: Divorce Papers May 20, 2026
- Chapter 670: A Mother’s Regret May 20, 2026
- Chapter 669: Cold Realization May 20, 2026
- Chapter 668: Quick Recovery May 20, 2026
- Chapter 667: Momentary Retreat May 20, 2026
- Chapter 666: Fuck Off May 20, 2026
- Chapter 665: Confronted May 20, 2026
- Chapter 664: Brutal Monster Battle May 20, 2026
- Chapter 663: Baited May 20, 2026
- Chapter 662: Pest Control May 20, 2026
- Chapter 661: Pushing Deeper May 20, 2026
- Chapter 660: Pigs May 20, 2026
- Chapter 659: Change of Plans May 20, 2026
- Chapter 658: Observing the Pests May 20, 2026
- Chapter 657: Forced Rivalry May 20, 2026
- Chapter 656: Two Distinct Fanbases May 20, 2026
- Chapter 655: Ice Cold May 20, 2026
- Chapter 654: Ash’s Proposal May 20, 2026
- Chapter 653: Unneeded Drama May 20, 2026
- Chapter 652: Surpassed Expectations May 20, 2026
- Chapter 651: Chaotic Morning May 20, 2026
- Chapter 650: Seven Days May 20, 2026
- Chapter 649: Not the Horn! May 20, 2026
- Chapter 648: The Competition Resumes May 20, 2026
- Chapter 647: Pushing to the Top May 20, 2026
- Chapter 646: Strategic Breakfast May 20, 2026
- Chapter 645: Harrowing Realization May 20, 2026
- Chapter 644: Guest in the Kitchen May 20, 2026
- Chapter 643: Vaelira’s Apology May 20, 2026
- Chapter 642: Wonderful Friends May 20, 2026
- Chapter 641: Wrong Attitude May 20, 2026
- Chapter 640: Obsolete May 20, 2026
- Chapter 639: Fate of Gangsters May 20, 2026
- Chapter 638: Scuffle May 20, 2026
- Chapter 637: Little Walk May 20, 2026
- Chapter 636: Gourmet Meal May 20, 2026
- Chapter 635: Masks Off May 20, 2026
- Chapter 634: The Location May 20, 2026
- Chapter 633: Night Out May 20, 2026
- Chapter 632: Incredible Progress May 20, 2026
- Chapter 631: Apology May 20, 2026
- Chapter 630: Different Worlds May 20, 2026
- Chapter 629: Questioned Parenting May 20, 2026
- Chapter 628: Cruel Mother May 20, 2026
- Chapter 627: Alexandra’s Decision May 20, 2026
- Chapter 626: Sacrifice May 20, 2026
- Chapter 625: Marcus and Elena May 20, 2026
- Chapter 624: Adorable Mother May 20, 2026
- Chapter 623: Bowing Deep May 20, 2026
- Chapter 622: Evening Plans May 20, 2026
- Chapter 621: Updates May 20, 2026
- Chapter 620: Grand Display May 20, 2026
- Chapter 619: Brutal Viewpoint May 20, 2026
- Chapter 618: Grace and the Chairman May 20, 2026
- Chapter 617: The New Paragon May 20, 2026
- Chapter 616: Upgraded Powers May 20, 2026
- Chapter 615: Moon and Dominion May 20, 2026
- Chapter 614: Badass Valkyries May 20, 2026
- Chapter 613: In the Queen’s Domain May 20, 2026
- Chapter 612: Making it Official May 20, 2026
- Chapter 611: The Three Fangirls May 20, 2026
- Chapter 610: Tense Environment May 20, 2026
- Chapter 609: Ashbound Films May 20, 2026
- Chapter 608: New Reality May 20, 2026
- Chapter 607: Intense Regret May 20, 2026
- Chapter 606: Manifestation May 20, 2026
- Chapter 605: Sorry May 20, 2026
- Chapter 604: Frantic May 20, 2026
- Chapter 603: Enraged May 20, 2026
- Chapter 602: No More May 20, 2026
- Chapter 601: Silent Dread May 20, 2026
- Chapter 600: What...? May 20, 2026
- Chapter 599: Reunited May 20, 2026
- Chapter 598: Girls’ Trials May 20, 2026
- Chapter 597: Eaten Out May 20, 2026
- Chapter 596: New Morning May 20, 2026
- Chapter 595: Wrapped in Warmth May 20, 2026
- Chapter 594: Aftermath May 20, 2026
- Chapter 593: Overwhelming Fury May 20, 2026
- Chapter 592: Suppressing Wrath May 20, 2026
- Chapter 591: Final Hurdle May 20, 2026
- Chapter 590: Pride’s Challenge May 20, 2026
- Chapter 589: Wrong Choice May 20, 2026
- Chapter 588: Friend May 20, 2026
- Chapter 587: Haughty Bitch vs Celestial Lunatic May 20, 2026
- Chapter 586: Haughty Bitch vs Demonic Maid May 20, 2026
- Chapter 585: The Trial’s Nature May 20, 2026
- Chapter 584: I See Now May 20, 2026
- Chapter 583: Epiphany May 20, 2026
- Chapter 582: Showdown of Gluttons May 20, 2026
- Chapter 581: The Heavenly Demon’s Challenge May 20, 2026
- Chapter 580: Aria’s Realization May 20, 2026
- Chapter 579: Eternal Hunger May 20, 2026
- Chapter 578: The Bottomless One May 20, 2026
- Chapter 577: The Sin of Gluttony May 20, 2026
- Chapter 576: Raw Sin Stances May 20, 2026
- Chapter 575: The Original Sin May 20, 2026
- Chapter 574: Crumbling Family May 20, 2026
- Chapter 573: Preparations Complete May 20, 2026
- Chapter 572: Lacking May 20, 2026
- Chapter 571: Overwritten Authority May 20, 2026
- Chapter 570: Warm Bath May 20, 2026
- Chapter 569: Explain, System May 20, 2026
- Chapter 568: Unexpected Development May 20, 2026
- Chapter 567: Time Skip May 20, 2026
- Chapter 566: No Dragon Balls May 20, 2026
- Chapter 565: Renoa May 20, 2026
- Chapter 564: Moving On May 20, 2026
- Chapter 563: Chaotic Chat May 20, 2026
- Chapter 562: Behemoth Battle May 20, 2026
- Chapter 561: Distinct Chatters May 20, 2026
- Chapter 560: Competent Hunters May 20, 2026
- Chapter 559: Second Day Begins May 20, 2026
- Chapter 558: Time to Turn Serious May 20, 2026
- Chapter 557: You, But Better May 20, 2026
- Chapter 556: The Ashen Knight May 20, 2026
- Chapter 555: New Faces May 20, 2026
- Chapter 554: Perfect May 20, 2026
- Chapter 553: Rise and Shine May 20, 2026
- Chapter 552: Glorious Morning May 20, 2026
- Chapter 551: Unexpected Warmth May 20, 2026
- Chapter 550: Making Waffles May 20, 2026
- Chapter 549: Waffle May 20, 2026
- Chapter 548: Sugar Addiction May 20, 2026
- Chapter 547: Blissful Night May 20, 2026
- Chapter 546: Getting Raided May 20, 2026
- Chapter 545: Needy Gals May 20, 2026
- Chapter 544: Beautiful Warrioresses May 20, 2026
- Chapter 543: New Stats May 20, 2026
- Chapter 542: Meeting End May 20, 2026
- Chapter 541: Kaiden’s Response May 20, 2026
- Chapter 540: Wrong Choice May 20, 2026
- Chapter 539: Accusations May 20, 2026
- Chapter 538: Private Wing May 20, 2026
- Chapter 537: Walk Back May 20, 2026
- Chapter 536: Needy Demoness May 20, 2026
- Chapter 535: Exhausted Aftermath May 20, 2026
- Chapter 534: The 7th Member May 20, 2026
- Chapter 533: Strong Monsters May 20, 2026
- Chapter 532: The Monster Slaying Begins May 20, 2026
- Chapter 531: Final Announcement May 20, 2026
- Chapter 530: Stream Start May 20, 2026
- Chapter 529: New Dawn’s Elite Squad May 20, 2026
- Chapter 528: Time to Begin May 20, 2026
- Chapter 527: Newbie Track May 20, 2026
- Chapter 526: Rules and Rewards May 20, 2026
- Chapter 525: Competition May 20, 2026
- Chapter 524: New Announcement May 20, 2026
- Chapter 523: Infuriated May 20, 2026
- Chapter 522: Fierce Little Sister May 20, 2026
- Chapter 521: Ashborn Sibling Reunion May 20, 2026
- Chapter 520: Rules May 20, 2026
- Chapter 519: Into the Camp May 20, 2026
- Chapter 518: Statement May 20, 2026
- Chapter 517: Rupert From AwaNews May 20, 2026
- Chapter 516: He’s Here May 20, 2026
- Chapter 515: Arrival May 20, 2026
- Chapter 514: New Farming Spot May 20, 2026
- Chapter 513: Masterful Marketing May 20, 2026
- Chapter 512: Who Are Valhalla’s Sinners? May 20, 2026
- Chapter 511 - Capítulo 511: A New Video May 20, 2026
- Chapter 510 - Capítulo 510: Unhinged Ladies May 20, 2026
- Chapter 509: Bored Girls May 20, 2026
- Chapter 508: Footing the Bill May 20, 2026
- Chapter 507: Dungeon-Born Stats May 20, 2026
- Chapter 506: Two Idiots and a Demoness May 20, 2026
- Chapter 505: Female Lead? May 20, 2026
- Chapter 504: Kaiden’s Thoughts of the Natives May 20, 2026
- Chapter 503: Dungeon-Born in Action May 20, 2026
- Chapter 502: New Day May 20, 2026
- Chapter 501: Toll May 20, 2026
- Chapter 500: Cute and Loving May 20, 2026
- Chapter 499: Little Sister Transformation May 20, 2026
- Chapter 498: Responsibility May 20, 2026
- Chapter 497: Guilt May 20, 2026
- Chapter 496: Unhinged Little Sister May 20, 2026
- Chapter 495: Can’t Have It All May 20, 2026
- Chapter 494: Pick Up The Soap, Motherfucker May 20, 2026
- Chapter 493: Iron Shepherd May 20, 2026
- Chapter 492: Saviors May 20, 2026
- Chapter 491: Guards! May 20, 2026
- Chapter 490: A Third Option May 20, 2026
- Chapter 489: Lockdown May 20, 2026
- Chapter 488: Ominous Voice May 20, 2026
- Chapter 487: Privacy Shield May 20, 2026
- Chapter 486: SKREEEEEEE May 20, 2026
- Chapter 485: Making Headway May 20, 2026
- Chapter 484: Slipping Morality May 20, 2026
- Chapter 483: Automatic Point Production May 20, 2026
- Chapter 482: Absolute Cinema May 20, 2026
- Chapter 481: Helpful System May 20, 2026
- Chapter 480: Frantic Humans, Chill Monsters May 20, 2026
- Chapter 479: Invaders May 20, 2026
- Chapter 478: Shoot For The Stars May 20, 2026
- Chapter 477: Reward May 20, 2026
- Chapter 476: Settling In May 20, 2026
- Chapter 475: Unfunny Children May 20, 2026
- Chapter 474: A New Purpose May 20, 2026
- Chapter 473: Dungeon Integration May 20, 2026
- Chapter 472: Dreamland May 20, 2026
- Chapter 471: Amusement Park May 20, 2026
- Chapter 470: Into the Dungeon May 20, 2026
- Chapter 469: Mother and Son May 20, 2026
- Chapter 468: Chieftain Kaiden May 20, 2026
- Chapter 467: Hectic Camp May 20, 2026
- Chapter 466: Demoness and Little Sister May 20, 2026
- Chapter 465: Chilling in Jail May 20, 2026
- Chapter 464: Questioned May 20, 2026
- Chapter 463: Reaction of the World May 20, 2026
- Chapter 462: Little Dragon May 20, 2026
- Chapter 461: Arrested May 20, 2026
- Chapter 460: Pig Slaughter May 20, 2026
- Chapter 459: Maximilian’s Nightmare May 20, 2026
- Chapter 458: Liberated May 20, 2026
- Chapter 457: A Man Who Can’t Look Away May 20, 2026
- Chapter 456 - Capítulo 456: Into the Underground Facility May 20, 2026
- Chapter 455 - Capítulo 455: Family Friendly POV May 20, 2026
- Chapter 454: Cruel Monster Girls May 20, 2026
- Chapter 453: Forceful Entry May 20, 2026
- Chapter 452 - Capítulo 452: New Stream May 20, 2026
- Chapter 451 - Capítulo 451: Alexandra's Letter May 20, 2026
- Chapter 450: Best Friends May 20, 2026
- Chapter 449: Letter May 20, 2026
- Chapter 448: New Crib May 20, 2026
- Chapter 447: Finalize May 20, 2026
- Chapter 446: Dungeon End May 20, 2026
- Chapter 445: Second Pathway May 20, 2026
- Chapter 444: Secret Kingdom May 20, 2026
- Chapter 443: Watched May 20, 2026
- Chapter 442: Strategizing May 20, 2026
- Chapter 441: Dungeon Ranks May 20, 2026
- Chapter 440: Melty May 20, 2026
- Chapter 439: Magma Rivers May 20, 2026
- Chapter 438: Dungeon Core May 20, 2026
- Chapter 437: Abyssal Dungeon May 20, 2026
- Chapter 436: Dungeon Theme May 20, 2026
- Chapter 435: Inheritance of a Boss Monster May 20, 2026
- Chapter 434: Demonic Seat of Power May 20, 2026
- Chapter 433: Plea of the Natives May 20, 2026
- Chapter 432: Accusation May 20, 2026
- Chapter 431: Tribal Business May 20, 2026
- Chapter 430: Intervention May 20, 2026
- Chapter 429: Monster Girl Tension May 20, 2026
- Chapter 428: This Shameless Motherfucker!! May 20, 2026
- Chapter 427: Not Permitted May 20, 2026
- Chapter 426 - Capítulo 426: Calypso's Warm Welcome May 20, 2026
- Chapter 425 - Capítulo 425: Demolition to Oblivion May 20, 2026
- Chapter 424: Playful Demoness May 20, 2026
- Chapter 423: Veil of Possession May 20, 2026
- Chapter 422: No Mistake May 20, 2026
- Chapter 421: What the Fuck May 20, 2026
- Chapter 420: Calypso May 20, 2026
- Chapter 419: Monster! May 20, 2026
- Chapter 418: Man Vs Monster May 20, 2026
- Chapter 417: The Great Demon of Wrath May 20, 2026
- Chapter 416: Overwhelming Rage May 20, 2026
- Chapter 415: Varek’s Offer May 20, 2026
- Chapter 414: Horrible Man May 20, 2026
- Chapter 413: The Miserable Taigi May 20, 2026
- Chapter 412: Drugs & Women May 20, 2026
- Chapter 411: Tribal Traditions May 20, 2026
- Chapter 410: Meeting Varek May 20, 2026
- Chapter 409 - Capítulo 409: Naira's Apology May 20, 2026
- Chapter 408 - Capítulo 408: Pictures and Decision May 20, 2026
- Chapter 407 - Capítulo 407: Strange Man May 20, 2026
- Chapter 406 - Capítulo 406: Trouble May 20, 2026
- Chapter 405 - Capítulo 405: The Native Camp May 20, 2026
- Chapter 404: No More Jealousy May 20, 2026
- Chapter 403: Social Kitten May 20, 2026
- Chapter 402: Territorial Woman May 20, 2026
- Chapter 401: Offer May 20, 2026
- Chapter 400 - Capítulo 400: Scary Pale One May 20, 2026
- Chapter 399 - Capítulo 399: Beast Mode May 20, 2026
- Chapter 398: Gluttony May 20, 2026
- Chapter 397: Meeting the Pale Ones May 20, 2026
- Chapter 396: Hellborne Ravagers May 20, 2026
- Chapter 395: Troubled Girl May 20, 2026
- Chapter 394: Moving Out May 20, 2026
- Chapter 393: Strategy May 20, 2026
- Chapter 392: Apology May 20, 2026
- Chapter 391: Cruel Girl May 20, 2026
- Chapter 390: No Mercy May 20, 2026
- Chapter 389: A Good Woman May 20, 2026
- Chapter 388: Done with the BS May 20, 2026
- Chapter 387: Passive Engine of Growth May 20, 2026
- Chapter 386: Alexandra’s Decision May 20, 2026
- Chapter 385: Cooking May 20, 2026
- Chapter 384: Knock! Knock! Knock! May 20, 2026
- Chapter 383: Announcement May 20, 2026
- Chapter 382: Do It, You Fat Slob May 20, 2026
- Chapter 381: Fury and Panic May 20, 2026
- Chapter 380: Lawyering Up May 20, 2026
- Chapter 379: Abrupt Apology May 20, 2026
- Chapter 378: Misbehaving Woman Correction May 20, 2026
- Chapter 377: Wrestling Match May 20, 2026
- Chapter 376: Making Love May 20, 2026
- Chapter 375: Pounding a Good Woman May 20, 2026
- Chapter 374: Incredible Sensations May 20, 2026
- Chapter 373: Greedy Girls May 20, 2026
- Chapter 372: Time for Annihilation May 20, 2026
- Chapter 371: Bittersweet Feelings May 20, 2026
- Chapter 370: Dying of Cringe May 20, 2026
- Chapter 369: Unexpected Hurdle May 20, 2026
- Chapter 368: Home At Last May 20, 2026
- Chapter 367: Posts and Comments May 20, 2026
- Chapter 366: Outrage of a Nation May 20, 2026
- Chapter 365: Alexandra’s Misery May 20, 2026
- Chapter 364: Two Posts May 20, 2026
- Chapter 363: Power Play May 20, 2026
- Chapter 362: Heroes of America May 20, 2026
- Chapter 361: Presidential Speech May 20, 2026
- Chapter 360: Brave Awakened May 20, 2026
- Chapter 359: Bragging Fangirl May 20, 2026
- Chapter 358: Done Nothing Wrong! May 20, 2026
- Chapter 357: Lesson Learned May 20, 2026
- Chapter 356: Alice’s Big Mistake! May 20, 2026
- Chapter 355: Drama Queen May 20, 2026
- Chapter 354: Controlled Escalation May 20, 2026
- Chapter 353: Global Scientific Community May 20, 2026
- Chapter 352: News Around the Globe May 20, 2026
- Chapter 351: Chatter in the Hospital May 20, 2026
- Chapter 350: The Paragon Supported by the Moon and Space Bab May 20, 2026
- Chapter 349: Large Beast May 20, 2026
- Chapter 348: Monster! May 20, 2026
- Chapter 347: Family in Danger May 20, 2026
- Chapter 346: Upgraded Wrath May 20, 2026
- Chapter 345: Humanity in Panic May 20, 2026
- Chapter 344: Herald of Change May 20, 2026
- Chapter 343: Constructix and Rendrix in Action May 20, 2026
- Chapter 342: Danger May 20, 2026
- Chapter 341: Strange Dungeon May 20, 2026
- Chapter 340: Morning May 20, 2026
- Chapter 339: Felinid Fellatio May 20, 2026
- Chapter 338: Securing Support May 20, 2026
- Chapter 337: Good Boy May 20, 2026
- Chapter 336: Alexandra’s Chains May 20, 2026
- Chapter 335: The Anal Slut’s Move May 20, 2026
- Chapter 334: Back to the Grind May 20, 2026
- Chapter 333: Chiding the Little Sis May 20, 2026
- Chapter 332: You Wouldn’t! May 20, 2026
- Chapter 331: Underground Facility May 20, 2026
- Chapter 330: Aftermath May 20, 2026
- Chapter 329: Yonuhana’s Words May 20, 2026
- Chapter 328: Alcohol and Hot Spring May 20, 2026
- Chapter 327: No Fucks Given May 20, 2026
- Chapter 326: They Must Despair! May 20, 2026
- Chapter 325: Celebration May 20, 2026
- Chapter 324: Fangirl Call May 20, 2026
- Chapter 323: Barraged by Saviors May 20, 2026
- Chapter 322: Nothing May 20, 2026
- Chapter 321: The Public's Reaction May 20, 2026
- Chapter 320: That's An Anomaly May 20, 2026
- Chapter 319: Conference May 20, 2026
- Chapter 318: They Made Their Move May 20, 2026
- Chapter 317: Successful Stream May 20, 2026
- Chapter 316: Mercilessly Plundered May 20, 2026
- Chapter 315: Devoured May 20, 2026
- Chapter 314: Shocking Realization May 20, 2026
- Chapter 313: Invaded by the Gremlin May 20, 2026
- Chapter 312: Nyx’s Suppressed Thoughts May 20, 2026
- Chapter 311: Leather Bound May 20, 2026
- Chapter 310: Nyx's Cry For Help May 20, 2026
- Chapter 309: New Mission May 20, 2026
- Chapter 308: End of Normal May 20, 2026
- Chapter 307: Where It All Began May 20, 2026
- Chapter 306: Quirky Women May 20, 2026
- Chapter 305: Steamy Bath May 20, 2026
- Chapter 304: Back on Earth May 20, 2026
- Chapter 303: What Do You Feel? May 20, 2026
- Chapter 302: Meeting of the Top Dogs May 20, 2026
- Chapter 301: Viktor’s Reaction May 20, 2026
- Chapter 300: End of the Hollow May 20, 2026
- Chapter 299: Finale May 20, 2026
- Chapter 298: Space May 20, 2026
- Chapter 297: Buffed Kai May 20, 2026
- Chapter 296: The Might of a Legendary Item May 20, 2026
- Chapter 295: The Gauntlet May 20, 2026
- Chapter 294: Feed! May 20, 2026
- Chapter 293: Thud! May 20, 2026
- Chapter 292: The Power of Space May 20, 2026
- Chapter 291: Enough May 20, 2026
- Chapter 290: New Form May 20, 2026
- Chapter 289: Vaelira's Swift Decision May 20, 2026
- Chapter 288: Mother and Son May 20, 2026
- Chapter 287: Confrontation May 20, 2026
- Chapter 286: Arachnid Lair May 20, 2026
- Chapter 285: Final Stretch May 20, 2026
- Chapter 284: Let Us Drink Too May 20, 2026
- Chapter 283: Vampire Family May 20, 2026
- Chapter 282: Please! May 20, 2026
- Chapter 281: Blood of the Paragon May 20, 2026
- Chapter 280: Desert Queen’s Dominion May 20, 2026
- Chapter 279: Boss Room May 20, 2026
- Chapter 278: Devious Plan May 20, 2026
- Chapter 277: Transformation May 20, 2026
- Chapter 276: Tragic Tale May 20, 2026
- Chapter 275: Bottleneck May 20, 2026
- Chapter 274: Ding! May 20, 2026
- Chapter 273: Gauntlet May 20, 2026
- Chapter 272: Pianist Kaiden May 20, 2026
- Chapter 271: Riddle of Sin May 20, 2026
- Chapter 270: Empress Execution May 20, 2026
- Chapter 269: Separated May 20, 2026
- Chapter 268: Strange Room May 20, 2026
- Chapter 267: Anxiety May 20, 2026
- Chapter 266: Shift May 20, 2026
- Chapter 265: Valkyrie Stats May 20, 2026
- Chapter 264: Failed Manipulation May 20, 2026
- Chapter 263: Horrible Accusation May 20, 2026
- Chapter 262: Suspicion May 20, 2026
- Chapter 261: Rapid Progression May 20, 2026
- Chapter 260: Blood Construct May 20, 2026
- Chapter 259: The Heart Hungers May 20, 2026
- Chapter 258: Might of the Sun May 20, 2026
- Chapter 257: Jealousy May 20, 2026
- Chapter 256: Ready to Burst May 20, 2026
- Chapter 255: Signing May 20, 2026
- Chapter 254: Bitch in Heat May 20, 2026
- Chapter 253: Nyah! May 20, 2026
- Chapter 252: One Last Thing May 20, 2026
- Chapter 251: Ironing Out The Details May 20, 2026
- Chapter 250: Floodgates May 20, 2026
- Chapter 249: Counter Offer May 20, 2026
- Chapter 248: Unbelievable Proposal May 20, 2026
- Chapter 247: Not Good Enough May 20, 2026
- Chapter 246: Tension May 20, 2026
- Chapter 245: Feast May 20, 2026
- Chapter 244: Released May 20, 2026
- Chapter 243: Back in Shape May 20, 2026
- Chapter 242: Respect May 20, 2026
- Chapter 241: Hospitalized May 20, 2026
- Chapter 240: Blame May 20, 2026
- Chapter 239: Tragedy May 20, 2026
- Chapter 238: Devouring May 20, 2026
- Chapter 237: New Trick May 20, 2026
- Chapter 236: Upgrading Adaptive Reflexes! May 20, 2026
- Chapter 235: Astral Carving May 20, 2026
- Chapter 234: Kaiden vs Fallen Vampire Noble May 20, 2026
- Chapter 233: Let’s Party! May 20, 2026
- Chapter 232: In a Bind May 20, 2026
- Chapter 231: Fallen Vampire Noble May 20, 2026
- Chapter 230: Praise May 20, 2026
- Chapter 229: Thralls May 20, 2026
- Chapter 228: Misguided May 20, 2026
- Chapter 227: Into the Vampire Crypt May 20, 2026
- Chapter 226: Time to Enter May 20, 2026
- Chapter 225: Preparing for the Undertaking May 20, 2026
- Chapter 224: New Gear May 20, 2026
- Chapter 223: Double Restriction May 20, 2026
- Chapter 222: Harsh Reality of Guilds May 20, 2026
- Chapter 221: Request May 20, 2026
- Chapter 220: Poor Boy May 20, 2026
- Chapter 219: Pride May 20, 2026
- Chapter 218: New Sin May 20, 2026
- Chapter 217: Crank It Up May 20, 2026
- Chapter 216: Grand Finale May 20, 2026
- Chapter 215: Gym Girl May 20, 2026
- Chapter 214: Luna’s Balancing Challenge May 20, 2026
- Chapter 213: Flexible Nyx May 20, 2026
- Chapter 212: Analyzing May 20, 2026
- Chapter 211: In the High Office May 20, 2026
- Chapter 210: Speech Struggles May 20, 2026
- Chapter 209: Bad Big Brother May 20, 2026
- Chapter 208: No Regrets May 20, 2026
- Chapter 207: Welcome Back May 20, 2026
- Chapter 206: Notification May 20, 2026
- Chapter 205: Bonus Trait May 20, 2026
- Chapter 204: Loophole May 20, 2026
- Chapter 203: Who’s right? May 20, 2026
- Chapter 202: Exposing the Truth May 20, 2026
- Chapter 201: Negotiating May 20, 2026
- Chapter 200: Great Boon May 20, 2026
- Chapter 199: Change of Plans May 20, 2026
- Chapter 198: Damn May 20, 2026
- Chapter 197: Explanation May 20, 2026
- Chapter 196: Revealing Everything May 20, 2026
- Chapter 195: The Shadow Monarch May 20, 2026
- Chapter 194: Into the Ashborn Residence May 20, 2026
- Chapter 193: Never! May 20, 2026
- Chapter 192: Long Time No See May 20, 2026
- Chapter 191: Heading Out May 20, 2026
- Chapter 190: Support May 20, 2026
- Chapter 189: Unexpected Reaction May 20, 2026
- Chapter 188: Mad Scientist vs Serene Fox May 20, 2026
- Chapter 187: No Refunds May 20, 2026
- Chapter 186: Questions, Questions, Questions May 20, 2026
- Chapter 185: Smack! May 20, 2026
- Chapter 184: Faith May 20, 2026
- Chapter 183: Nuclear Threat May 20, 2026
- Chapter 182: He Dares?! May 20, 2026
- Chapter 181: Too Many Questions May 20, 2026
- Chapter 180: Quirky Chat May 20, 2026
- Chapter 179: Live May 20, 2026
- Chapter 178: Going Live May 20, 2026
- Chapter 177: Announcement May 20, 2026
- Chapter 176: Maximilian’s Rage May 20, 2026
- Chapter 175: Income May 20, 2026
- Chapter 174: Incredible Gains May 20, 2026
- Chapter 173: Sync Class May 20, 2026
- Chapter 172: Classes and Levels May 20, 2026
- Chapter 171: The Yandere is Growing! May 20, 2026
- Chapter 170: Home Situation May 20, 2026
- Chapter 169: Differences Between Twins May 20, 2026
- Chapter 168: Getting Along May 20, 2026
- Chapter 167: Introductions May 20, 2026
- Chapter 166: Riven and Rae May 20, 2026
- Chapter 165: New Bodyguards May 20, 2026
- Chapter 164: New Home May 20, 2026
- Chapter 163: But? May 20, 2026
- Chapter 162: Aria’s Plan May 20, 2026
- Chapter 161: Buying a Teenage Girl May 20, 2026
- Chapter 160: Going Home May 20, 2026
- Chapter 159: Aria Has Had Enough May 20, 2026
- Chapter 158: Subjugation Complete! May 20, 2026
- Chapter 157: Reaction of the World 2 May 20, 2026
- Chapter 156: Reaction of the World 1 May 20, 2026
- Chapter 155: Making History May 20, 2026
- Chapter 154: Subjugation May 20, 2026
- Chapter 153: The Pleasures of Being Born a Woman May 20, 2026
- Chapter 152: Tanned Kittens Come Pre-Drenched May 20, 2026
- Chapter 151: Uhh... Kai, what’s going on? May 20, 2026
- Chapter 150: Again! May 20, 2026
- Chapter 149: The Puppeteer's Cruelty May 20, 2026
- Chapter 148: Boss Battle May 20, 2026
- Chapter 147: Bastet, the Sun-Kissed Pharaoh May 20, 2026
- Chapter 146: Twin Royal Guards May 20, 2026
- Chapter 145: Speaking with Vaelira May 20, 2026
- Chapter 144: Illusion May 20, 2026
- Chapter 143: Tense Silence May 20, 2026
- Chapter 142: Damned Desert Heat! May 20, 2026
- Chapter 141: Chilling in the Oasis May 20, 2026
- Chapter 140: Outrage May 20, 2026
- Chapter 139: Accused May 20, 2026
- Chapter 138: Dune Maw Battle May 20, 2026
- Chapter 137: Dune Maw Ambush May 20, 2026
- Chapter 136: Battle Against the Mummies May 20, 2026
- Chapter 135: Desert Monsters May 20, 2026
- Chapter 134: Pack Rat May 20, 2026
- Chapter 133: Into the Desert Dungeon! May 20, 2026
- Chapter 132: Cleared to Proceed May 20, 2026
- Chapter 131: Kaiden's Conviction May 20, 2026
- Chapter 130: Promise May 20, 2026
- Chapter 129: Meeting the Team May 20, 2026
- Chapter 128: Duties of Official Guilds May 20, 2026
- Chapter 127 127: Nova Circuit May 20, 2026
- Chapter 126 126: Holy Trinity May 20, 2026
- Chapter 125 125: Calling Vespera May 20, 2026
- Chapter 124 124: Yandere Princess May 20, 2026
- Chapter 123 123: Badass Girls May 20, 2026
- Chapter 122 122: Upgraded Valkyries May 20, 2026
- Chapter 121 121: Realization May 20, 2026
- Chapter 120 120: Family Drama May 20, 2026
- Chapter 119 119: Immense Luck! May 20, 2026
- Chapter 118 118: Reunion of Mother and Daughter May 20, 2026
- Chapter 117 117: Police Interrogation May 20, 2026
- Chapter 116 116: Devouring Life May 20, 2026
- Chapter 115 115: A Real Punch May 20, 2026
- Chapter 114 114: Andre May 20, 2026
- Chapter 113 113: The Levanders' Tragedy May 20, 2026
- Chapter 112 112: Julia Levander May 20, 2026
- Chapter 111 111: Visiting the Slums May 20, 2026
- Chapter 110 110: New Sin! May 20, 2026
- Chapter 109 109: Budding Star May 20, 2026
- Chapter 108 108: Foursome May 20, 2026
- Chapter 107 107: Disorderly Conduct May 20, 2026
- Chapter 106 106: Teamwork May 20, 2026
- Chapter 105 105: Fierce Kittens May 20, 2026
- Chapter 104 104: Madame Spice May 20, 2026
- Chapter 103 103: An Unexpected Guest May 20, 2026
- Chapter 102 102: Teaching New Tricks to an Old Dog May 20, 2026
- Chapter 101 101: Preparing the Ingredients May 20, 2026
- Chapter 100 100: Diligent Little Cooks May 20, 2026
- Chapter 99 99: Monster Cooking Stream! May 20, 2026
- Chapter 98 98: Renting a Home May 20, 2026
- Chapter 97 97: Housing Agency May 20, 2026
- Chapter 96 96: Next in Store May 20, 2026
- Chapter 95 95: Little Sister Gone Rogue May 20, 2026
- Chapter 94 94: Dire Wolf Ambush May 20, 2026
- Chapter 93 93: Stat Mechanics May 20, 2026
- Chapter 92 92: Combined Assault May 20, 2026
- Chapter 91 91: Silverback Mauler May 20, 2026
- Chapter 90: Giving Chase May 20, 2026
- Chapter 89: Meeting Theodore May 20, 2026
- Chapter 88: Power of the Valkyries May 20, 2026
- Chapter 87: First Monster Encounter May 20, 2026
- Chapter 86: Dungeon Descent May 20, 2026
- Chapter 85: Gearing Up May 20, 2026
- Chapter 84: Rare Gem May 20, 2026
- Chapter 83: Boiling Rage May 20, 2026
- Chapter 82: Story Time May 20, 2026
- Chapter 81: Splurty Time May 20, 2026
- Chapter 80: Collection Procedure May 20, 2026
- Chapter 79: Miss Nurse! May 20, 2026
- Chapter 78: Major News May 20, 2026
- Chapter 77: Pesky Fangirl Statistic May 20, 2026
- Chapter 76: Catfight May 20, 2026
- Chapter 75: Jealous Girlfriends May 20, 2026
- Chapter 74: Picture for the Fans May 20, 2026
- Chapter 73: Hospitalized May 20, 2026
- Chapter 72: Aftermath of the Duel May 20, 2026
- Chapter 71: Reaction of the Chairman May 20, 2026
- Chapter 70: Shock May 20, 2026
- Chapter 69: First Fight of the Paragon of Sin May 20, 2026
- Chapter 68: Kaiden’s Challenge May 20, 2026
- Chapter 67: Registration Complete! May 20, 2026
- Chapter 66: Shocking Findings May 20, 2026
- Chapter 65: Awakened Tiers May 20, 2026
- Chapter 64: New Main Quest May 20, 2026
- Chapter 63: Allfather and Valkyrie May 20, 2026
- Chapter 62: Seated May 20, 2026
- Chapter 61: Greeting the Fountain of Life May 20, 2026
- Chapter 60: Valkyrie RP May 20, 2026
- Chapter 59: Nyx’s Ploy May 20, 2026
- Chapter 58: What the hell is that!!! May 20, 2026
- Chapter 57: Sarah’s Reaction May 20, 2026
- Chapter 56: Supreme Empress’ Boyfriend May 20, 2026
- Chapter 55: Less Talking, More May 20, 2026
- Chapter 54: Slap! Slap! May 20, 2026
- Chapter 53: Time to Shower May 20, 2026
- Chapter 52: Morning May 20, 2026
- Chapter 51: Lock In May 20, 2026
- Chapter 50: Gremlin Girl May 20, 2026
- Chapter 49: Getting Comfy May 20, 2026
- Chapter 48: W-w-w-what?! May 20, 2026
- Chapter 47: Babysitting May 20, 2026
- Chapter 46: Visiting Aria’s Place May 20, 2026
- Chapter 45: Alice Ashborn May 20, 2026
- Chapter 44: The Relationship May 20, 2026
- Chapter 43: Badass Valkyries May 20, 2026
- Chapter 42: Demonic Pornstar System May 20, 2026
- Chapter 41: The Girls’ Decision May 20, 2026
- Chapter 40: The Plan May 20, 2026
- Chapter 39: Revelation May 20, 2026
- Chapter 38: Vespera Ashborn May 20, 2026
- Chapter 37: Glazing May 20, 2026
- Chapter 36: Pacifying a Jealous Beauty May 20, 2026
- Chapter 35: Taking Him In May 20, 2026
- Chapter 34: Boobs Rule the World May 20, 2026
- Chapter 33: New Offer May 20, 2026
- Chapter 32: No Stopping May 20, 2026
- Chapter 31: Aria’s First Time May 20, 2026
- Chapter 30: Final Preparations May 20, 2026
- Chapter 29: To the Shoot! May 20, 2026
- Chapter 28: Luna’s Story May 20, 2026
- Chapter 27: Sleepover May 20, 2026
- Chapter 26: Competitive Girls May 20, 2026
- Chapter 25: Promise May 20, 2026
- Chapter 24: Heated Lap Dance May 20, 2026
- Chapter 23: Ice Breaker May 20, 2026
- Chapter 22: Time for a Game May 20, 2026
- Chapter 21: Bold Girl May 20, 2026
- Chapter 20: Refusal May 20, 2026
- Chapter 19: Just Five? May 20, 2026
- Chapter 18: Nyx May 20, 2026
- Chapter 17: Awakened May 20, 2026
- Chapter 16: Life-Changing Decision May 20, 2026
- Chapter 15: Checking the Rewards May 20, 2026
- Chapter 14: Time Skip May 20, 2026
- Chapter 13: Snapping Pics May 20, 2026
- Chapter 12: Releasing the Kraken May 20, 2026
- Chapter 11: Luna’s Challenge May 20, 2026
- Chapter 10: Asking for Help May 20, 2026
- Chapter 9: Gardener Girl May 20, 2026
- Chapter 8: Awakened Platform Functions May 20, 2026
- Chapter 7: Childhood Rival May 20, 2026
- Chapter 6: Offer May 20, 2026
- Chapter 5: Rude System May 20, 2026
- Chapter 4: Buying Tools May 20, 2026
- Chapter 3: Working Out May 20, 2026
- Chapter 2: Regaining the Joy of Life May 20, 2026
- Chapter 1: New Start May 20, 2026
Reviews
0 comments