Latest Updates
Fresh chapters from recently updated English novels.
Latest Updated Novels
18196 titles-
DetailsThe Supreme Soldier King of the Lady CEO
[2020’sMostThrillingSoldierKingNovelOnline!]TheDarkWorld’snumberoneassassin—YeHuan,whostrikesfearintotheheartsofleadersacrossnations,isforcedtoreturntoHuaxiaandmarryanicyCEOduetoanorderfromhismentor.Simplicitya
Latest Chapter Chapter 1320 - 1300: Emperor Shitian, Master of Sequence?! Jun 07, 2026 17:57 -
DetailsI Outworked the Entire Cultivation World
TheImmortalcaressedmyhead,tyingmyhairandreceivinglongevity.Alonegirl,JiangYuebai,ascendsNinefoldMountaintotheAzureClouds,onlytoseektheImmortal’spath,wanderingtheworldandCloudStepping.ThepathofImmortalCultivationdefiesthe
Latest Chapter Chapter 474 - 430: Golden Snake Sword Palm Jun 07, 2026 17:35 -
DetailsEnchanting His Heart: His Little Fox
Thefirsttimetheymeet,hearrestsherundersuspicionsthatshe'sinvolvedinamurdercase.He'ssohandsomethatshe,astheheadofanentertainmentcompany,isdeterminedtorecruithimintohercompany,trainhimtobeastar,andmakehimhercashcow!Butheis
Latest Chapter Chapter 450 - 448: Find a Handsome Brother to Bring Home Jun 07, 2026 17:35 -
DetailsRebirth Sweet Wife, Super Cute
【1v1face-slappingpeerlesspamperingnovel,mutualpamperingbetweenhusbandandwife,abuseofscumanddog】“Let'sgo,marryme,I'llcovertheexpenses!”Beforeherrebirth,shewasblindanddidn'twantherhandsomehusband.Afterbeingreborn,sheonlywa
Latest Chapter Chapter 507: There Might Be New Discoveries Jun 07, 2026 17:35 -
DetailsWarm Married Life: Mr. President Loves His Darling Wife
“DamianSinclair,yousaidyouwouldn’ttouchme,wouldn'tlikeme,andwouldn’tmarryme!”“Darling,youmustbemistaken.Iclearlywanttosleepwithyou,likeyoualot,andholdacertificateofmarriage!”“You...you'reshameless,goingbackonyourword!”“B
Latest Chapter Chapter 474 - 473: Faking a Relationship for Hype Jun 07, 2026 17:35 -
DetailsReborn with the Infinite World Panel
AfterbeingkilledbyamonsterintheInfiniteWorld,Qingyiisreincarnatedintothemodernworld,inthebodyofacontroversialstarnamedNanChu.QingyitakesoverNanChu'slife,embarkingonanewjourney,andfindslove,friendship...
Latest Chapter Chapter 507 - 290: Cultivation World 80 Jun 07, 2026 17:35 -
DetailsThe Deadly Hitwoman: The Heiress's Special Abilities
WhenHanJing,ahitwomanwithspecialabilities,transmigratedintothenastyandarrogantLadyHan,sheusedherprivilegetobedomineeringtothemax!!Herfiancédespisedherandprovokedherrepeatedlysoshebrokeofftheengagement!Shethengotmarriedto
Latest Chapter Chapter 743: Stay by My Side Jun 07, 2026 17:35 -
DetailsReborn as the Sweetheart of a Paranoid Boss
“Evenindeath,youwon'tescapefromme.”Hisvoicewasterrifying,buthisdeepblueeyesheldaffectionandobsession.Inthissecondchanceatlife,SelenaKensingtonwasdeterminedtobreakfreefromherpastdestiny.So,shewillinglybecamethe'wifeofamon
Latest Chapter Chapter 757: Interrogating the Pseudo-Type Jun 07, 2026 17:35 -
DetailsImperial Treasure
Tobeexact,thefemaleleadisan“oldersister”type,amidmanybeautiesandhandsomeguys,she'snowhitelotus.Also,it'ssaidthatthenameofthisbookisthesameasabrandofsheep'smilkpowder.
Latest Chapter Chapter 1370 - 788: Wang Qing (Clover vs. Lucky ) Jun 07, 2026 17:35 -
DetailsCorpse Burier: I Can Nourish Corpse
WenJiuhastransmigratedtoacultivationworldasacorpseburier.Afteranotherhard-workingday,hecursesfiercelythatonlinewritersareallfrauds,becausehedoesn'thaveanygoldenfingers.Yetjustontheverynight,hissystemawakens.【Today'sSettl
Latest Chapter Chapter 470 - 242: Life-long Spirit Contract and Journey to Jun 07, 2026 17:24 -
DetailsObtaining Top Art on Family's Extermination Night
FangShuwentransmigratedtoamartialartsworld,weathered19yearsofhardship,andtriedhisutmost,yethewasfatedtoneverachievegreatsuccessinmartialarts,onlymanagingtobecomealowlyHospitalMartialArtistfortheZhouFamily.Unexpectedly,th
Latest Chapter Chapter 210 - 130: I Don’t Know You Jun 07, 2026 17:24 -
DetailsPursued by the Top Grade Saintess after Engagement Annulled
XiaFengtransmigratedtotheCelestialEssenceContinent,becomingalow-talentwaste.Fortunately,hepossessedaDreamRealmPearl,whichaccidentallypulledthetopgradeSaintessoftheGreatXiaEmpireintothedreamrealm,wheretheyfellinloveforath
Latest Chapter Chapter 639 - 635: The Life Staff Overpowers Morris Jun 07, 2026 17:24 -
DetailsMaster of Nine Stars
“I,RongTaotao,willonedaybecometheMasterofNineStars.”Thatyear,ayoungboycarryingasmallschoolbag,withnaturallycurlyhairandholdingaHeaven-piercingHalberd,saidsoonarooftop....
Latest Chapter Chapter 177 - 132: So-called Happiness Jun 07, 2026 17:13 -
DetailsHeroes' Prison
Somepeoplearedestinedtomeet,evenifoneisinHeavenandtheotherinHell.RosePrison,thenumberoneprisonintherealworld!Herearedetainedtheworld'stopcriminals,businesselites,politicalgiants,superhackers,andevennuclearweaponsexperts.
Latest Chapter Chapter 1831 - 1749: Battle of the Five Supreme Gods, Infini Jun 07, 2026 17:13 -
DetailsShennong Dao Master
【BrandNewSetting】【FullyDevelopedSystem】Whenyouawoke,youhadbecomeanofficialknownas“MinisterofAgriculture”inafantasygame.“Dynasty'sProsperity”version:Youdiligentlycultivatedthe“SeasonalOrder,”from“HarmonizingWindsandRains”
Latest Chapter Chapter 1765 - 6: The Attempt in the Year 1008! (Part 3) Jun 07, 2026 17:13 -
DetailsMech: Shattering of the Galaxy
Dreamsare…arealitythatonlythosewhoarecapablecanspeakabout.Thiswasaneramarkedbythebirthsofgeniuses!Thiswasanerawhereheroescouldbefoundeverywhere!Thefierceconflictbetweenthearistocratsandthecivilians,theopenandveiledbattle
Latest Chapter Chapter 1603 - 119: Consecutive Slays (Part 2) Jun 07, 2026 17:12 -
DetailsThis Giant Dragon is So Powerful!
AsoulfromtheEarthtransmigratedandwasrebornasanewlyhatchedlittleblackdragon.Badnews:Hisdragonmotherhasbeentargetedbyahumankingdom,whichhasalreadydispatchedamassivedragon-slayingarmy.Goodnews:HeawakenedaTalent:[Feast&
Latest Chapter Chapter 282 - 64: The Fallen Legendary Dragon; Tal’s Complet Jun 07, 2026 17:02 -
DetailsMy Wife Might Be a Saintess
JiangZuohasabeautifulwife,butsheoftengoesonbusinesstrips.Todowhat?It'snotthatshe'sbusycuckoldinghim,butrathershe'sgonetovanquishdemonsandslaydevils.Uponlearningthetruth,JiangZuosighedrepeatedly.Itseemshecan'tsitstillanym
Latest Chapter Chapter 239 - 238: The Celestial Tribulation Arrives Jun 07, 2026 17:02 -
DetailsI Have an Omen System
QinXuantransmigratedintoaFantasyWorld,obtainingaGoldenFingerthathelpshimseekfortuneandavoiddisaster.Beforehimweretwopeople:onewasaGreatDemonwhohadslaughteredcountlesspeople,theotherwasarenownedpeerlessprodigyoftheRighteo
Latest Chapter Chapter 285 - 206: Qingming Secret Realm (3) Jun 07, 2026 17:02 -
DetailsThe Low-key Evil Wizard BOSS
Zornhastransmigratedintoagameworld.ThegoodnewsisthathebecomesthenotoriousWorld-levelBOSS,the[EvilSpiritWizard].Andaccordingtotheplot,heisdestinedtoascendtothepinnacleofanevillife.However,thebadnewsisthathisasce
Latest Chapter Chapter 238 - 124: Demon’s Advent Jun 07, 2026 17:02