Font Size
15px

Chapter 59: Chapter 48 Destroying the Formation_1 Chapter 59: Chapter 48 Destroying the Formation_1 Top floor of the White Tower.

Clutching the spear, Pang Jian squinted his eyes, deeply imrsing himself in the surge of Spiritual Power, his gaze becoming as sharp as the spear’s tip.

“Swoosh! Swoosh swoosh!”

Lightning-fast Spiritual Power burst forth from the palm of his hand holding the spear, the speed so great that it made his heart race.

Before he could react, dazzling light suddenly shone out, making the dark room abruptly bright!

Looking down, he saw that on the spear’s shaft, lines like dragon patterns lit up one by one!

When the Long Spear glowed, Pang Jian clearly felt that the Cyan Shining Spirit Power he poured into the shaft was suddenly amplified in force and sharpness through the dragon-patterned Array.

Force, ant that when he swung the Long Spear, his strength would see an explosive increase.

Edge, referred to the edge of the Dragon Pattern Spear, which would beco incomparably sharp.

“Hiss!”

A beam of cyan light shot out from the tip of the Dragon Pattern Spear, “ding” a stone on the Soul Array was struck.

Pang Jian focused his gaze and saw a very shallow small hole on the stone.

The hole, the size of a pinky finger, looked like a small groove, and the tip of the Dragon Pattern Spear hadn’t truly touched the stone.

Pang Jian was greatly encouraged!

Previously,

He had been unable to leave a mark on those stones using brute force with the Dragon Pattern Spear, unable to shift them.

Now,

Having only opened four ridians, the enhancent from the Spirit Array within the Dragon Pattern Spear allowed him to leave a trace on the stone.

This ant he could break the Array!

The next mont, Pang Jian pushed off with his feet to drive his waist, twisting his body to swing the Dragon Pattern Spear, combining it with the infusion of Spiritual Power!

The Long Spear suddenly straightened, blinding light burst forth from the tip, and the dark room appeared as if a tiny sun had suddenly erged!

Pang Jian’s vision blurred, and he took advantage of the montum to stab the spear towards the skull-shaped Soul Array.

His body’s Spiritual Power responded to his movent, flooding into the Dragon Pattern Spear, acquiring both sharpness and force from the two dragon-patterned Arrays, causing the light from the spear tip to beco even more dazzling!

Outside the White Tower, Zhou Qingchen and others were shocked by the sudden brightness on the fifth floor, and couldn’t help but look over.

“Pfft!”

A stone containing “Mysterious Yin Power” was pierced through by Pang Jian in one strike—the spear tip sank deep into the hollowed-out skull.

The Spirit Turtle, surrounded by countless mosquito-like Soul Spirits and Ghost Objects, constantly worn down in Spiritual Intelligence, suddenly perceived the spear tip’s ergence.

It opened its eyes once again, laboriously turned around, and gazed faintly at the spear tip that had entered the skull.

Pang Jian, having made his hit, suddenly exerted strength with a grin and yanked the Dragon Pattern Spear out!

As the Dragon Pattern Spear withdrew, the eerily built skull from nurous odd stones suddenly began to collapse.

The cohesive Soul Array, damaged in one place, directly affected the whole.

“Crack crack crack!”

The intricately designed Soul Array, like a pagoda experiencing an earthquake, saw its stones breaking apart and falling to the ground.

Only then did the Spirit Turtle dare to believe that the Soul Array imprisoning it had been destroyed.

The Spirit Turtle, quietly shrieking, broke free and shot towards the sky, ignoring the tower’s summit and directly passing through it to hover above the solitary island.

“Whoosh! Whoosh whoosh whoosh!”

The Soul Spirits and Ghost Objects swirling around it flew out from the skull’s interior, escaping through the four windows on the fifth floor.

Pang Jian was astounded.

He saw the mosquito-like Soul Spirits, once they left the collapsing skull, suddenly expand a hundredfold into vague soul shadows.

So soul shadows were clearly human, so resembled the mightiest beasts of the Solitude Mountain Range, while others were neither human nor beast, beings he had never seen before.

“That Spirit Turtle…”

He suddenly woke up, leaped from an open window, and after crashing to the ground, he looked up to the sky.

Under the dark and gloomy sky, nearly a hundred Soul Spirits and Ghost Objects were howling in their attempt to flee the solitary island at Lake Heart.

At the highest point,

A deep green giant turtle spreading over a dozen acres hovered steadily mid-air, its eyes filled with a mournful rembrance as it looked down at the island below.

It was full of reluctance, seemingly unwilling to leave this domain of its own, not ready to set off on a new journey.

“Pang Jian succeeded!”

“He destroyed the Soul Array atop the Heavenly Spirit Tower, and all the imprisoned Soul Spirits and Ghost Objects have been released by him!”

“The most terrifying function of the Heavenly Spirit Tower has been nullified!”

Han Duping, Su ng, including He Rong were all screaming excitedly at this mont, each one looking up to behold the Soul Spirits and Ghost Objects freeing themselves from the Heavenly Spirit Tower.

Also at this ti,

Several clear figures of “Spirit Evils” suddenly floated out from the edges of Lake Heart Island, starting to assail the weaker Soul Spirits and Ghost Objects.

Among these “Spirit Evils,” two were familiar faces to Zhou Qingchen and Han Duping—Hong Tai and Roman!

“The Demon Girl is also on the island, Hong Tai was killed by her!”

Han Duping was extrely terrified.

The Dark Ghost Hong Tai had actually died, even being refined into a “Spirit Evil”, which indicated that the Demon Girl they had encountered in the stone pile had recovered a lot of her strength.

“Roman, Roman…”

Shangguan Qin, whose movents were confined and who could only guard that ancient well, was also startled by the activity atop the low mountain. She, too, had seen the clear figure of Roman.

“It wasn’t a hallucination. That night, it truly was Roman! He’s shown himself, co to see , even after death he ca to see !”

Shangguan Qin could no longer contain herself, and in that mont, she forgot she was supposed to keep silent, crying out in wild, mournful sobs.

She strained to stand on tiptoe, frantically waving her hands towards Roman, who no longer recognized her and had beco a “Spirit Evil,” hoping he would co to her as he used to.

In the skies above.

The enormous Beast Soul of the Spirit Turtle was lingering sentintally over the solitary island, reminiscing about tis long past.

But when a series of Spirit Evils, just like Hong Tai and Roman, suddenly burst forth from around the island, the Spirit Turtle dared not dwell on the past any longer and hastily flew towards the north of the mountain.

“Boom!”

The soul form of the Spirit Turtle, as if it had struck against an invisible Sky Curtain, caused a thunderous vibration over the isolated island.

The Spirit Turtle hesitated for a mont, quickly condensing into a beam of green ghostly light and once again heading towards the Extre North Land of the Solitude Mountain Range.

“Hiss!”

Like piercing through a barrier’s mbrane, the ghostly light form of the Spirit Turtle broke free from the seal.

The hosts of Soul Spirits and Ghost Objects that had been surrounding it, however, lacked the ability to break the seal. Under the pursuit of the Spirit Evils, they were gradually consud and absorbed one by one.

“The sky do, indeed, has a seal in place, and it was sealing a… Mysterious Turtle.”

Standing at the summit of the low mountain and having a view of Shangguan Qin and the ancient well, Luo Hongyan watched as the soul of the Spirit Turtle departed, and she did not dare to command the Spirit Evils to chase it.

The Mysterious Turtle, a rare Spirit Beast found in the Upper Realm, was more powerful than the Dark Giant Python of Black Water Pool.

Even in its soul form, the Mysterious Turtle was far stronger than the Spirit Evils she had crafted. Were it not for the Mysterious Turtle’s own reservations, Spirit Evils like Hong Tai and Roman would have beco its prey.

“The three Forbidden Lands of the Solitude Mountain Range, Black Water Pool, Insect Valley, and Lake Heart Island, all contain miraculous and strange objects. The Dark Giant Python of Black Water Pool, the huge beehive of Insect Valley, and this Mysterious Turtle.”

“The person behind all this, below, managed to reach the fifth level of Eternal Darkness and capture a Dark Giant Python. Above, they were able to go to the second or even the first level, capturing a Mysterious Turtle here!”>

“Such a person…”

Watching the Mysterious Turtle fade into the distance, Luo Hongyan’s brow furrowed, and she couldn’t help but look towards the massive well.

“If the man in that well is the creator of the three Forbidden Lands, then everyone on the island…”

A bitter smile appeared on her lips.

Suddenly.

Due to the destruction of the Soul Array inside the White Tower, a group of Soul Spirits and Ghost Objects began escaping, and it seed that the being subrged within the ancient well was finally disturbed.

“Ah!”

Shangguan Qin was the first to cry out in alarm.

Her cry of alarm also brought the people gazing at the sky back to their senses instantly; they had been hoping Pang Jian would break the Soul Array because they feared the individual within the well.

They feared that this person, upon erging, could once again take control of the “Heavenly Spirit Tower” and use the Soul Array to absorb the souls of everyone present.

Shangguan Qin’s terrified scream was undoubtedly a sign that there was a stir below the well—that person… was finally coming out!

People imdiately crowded towards the top of the low mountain; everyone wanted to face the well directly, eager to clearly see who was erging.

At that mont, as the Array was disrupted and he saw the Spirit Evils attacking the Soul Spirits and Ghost Objects, Pang Jian, who was aware that the Demon Girl from the pile of stones was on the island, also rushed over quickly.

“Pang Jian, congratulations! You really have so skills!”

Seeing him arrive, Zhou Qingchen shoved aside Han Duping to clear a spot for him.

Ignoring Han Duping’s discontent, Zhou Qingchen said with a beaming smile, “You’ve entered the ridians Channeling Realm and opened up a ridian with the Dragon Pattern Spear to break the Soul Array. I truly wasn’t wrong about you!”

Pang Jian did not share that he, in one go, had opened up four arm ridians, instead responding, “The Dragon Pattern Spear you gave is really handy.”

“The Dragon Pattern Spear is only a basic Spiritual Artifact. But you see, a Spiritual Artifact is fundantally different from the Long Blade you used to wield because it can bear Spiritual Power, allowing the power to flow within it—sothing that a re weapon could never achieve.”

Zhou Qingchen continued with a laugh, “When I gifted you the Dragon Pattern Spear, it was because I knew you would definitely enter the ridians Channeling Realm! I just didn’t expect you to do it so quickly!”

As he chatted with Pang Jian, he occasionally glanced over at Shangguan Qin, keeping his eyes on the well beside her.

The others did the sa.

“Co over here.”

Standing highest on the summit, maintaining a distance from the others, and always standing out from the crowd, Luo Hongyan beckoned Pang Jian over.

Zhou Qingchen fell silent, jestingly winked and smiled, “I heard that, after we parted, this young lady’s attitude towards you has greatly improved.”

“Mhm, she has indeed changed a lot.”

Pang Jian walked towards Luo Hongyan.

“He’s out!”

He Rong suddenly exclaid in a low voice.

A sea of inquisitive eyes focused intently on the great well ford by the fall of the Phoenix Bone.

Then they saw a naked man, sared in thick blood, climbing out of the well at an unhurried pace.

His face, hair, and every part of him were coated with sticky blood, making his true appearance unknown to the onlookers.

Shangguan Qin looked at him as if seeing the most terrifying demon in the world, trembling uncontrollably.

He, however, smiled at Shangguan Qin and, as she shuddered in horror, he lifted his head to glance at the low mountain before looking at Pang Jian and the others lined up there.

Ultimately, he said nothing, imdiately leaping into the nearby Wulan Lake and began to wash off the thick blood covering his body of his own accord.

You are reading The Purgatory Calamity Chapter 59 - 59 48 Destroying the Formation1 on novel69. Use the chapter navigation above or below to continue reading the latest translated chapters.
Share with your friends
Library saves books to your account. Reading History saves recent chapters in this browser.
Continuous reading

You may also like

God of Slaughter cover
Same author

God of Slaughter

Ni Cang Tian ·Action

Growingupparentless,ShiYan,whowasleftwithalargeinheritancemoney,boreageneraldisinterestinlife. Theonlytimeshefeltalivewaswhenadrenalinecoursedthoro...

Great Demon King cover
Same author

Great Demon King

Ni Cang Tian ·Action

“IfIdon’tdie...IswearIwillactonallmyevilthoughts..” Notexactlyeveryone’stypicalthoughtwhenthey’reabouttodie.Whatwillacowardlyyoungmandowhenreincarn...

No reviews yet. Be the first reader to leave one.
Please create an account or sign in to post a comment.