Font Size
15px

Chapter 938: Being Generous

The news that the ghouls had been struck a grievous blow spread to every corner of the Land of Chaos like wildfire.

After being subjected to three years of stifling pressure by the three great ghoul races, the news roused every great human forces.

After that, all great Silver rank forces—Terminator Sect, Heavenly Sword Mountain, Black Voodoo Cult, the three great families, Ten Thousand Beast Mountain, and Celestial Artifact Sect—sprung into action.

That wasn’t all. The rest of the human forces also participated in the operation to encircle and annihilate the three ghoul races.

The three ghoul races turned into street rats in an instant. Their bases at the Heavenly Calamity Continent, the Heavenly Slaughter Continent, Prism Continent and so on were all attacked by the human Silver rank forces.

The situation where the three ghoul races were pletely suppressing the human race was pletely reversed.

Not long after, the bined force of Black Voodoo Cult and the three great families attacked Illusory Demon Sect’s old haunt and heavily injured a group of Blue Ghoul clansmen.

Ten Thousand Beast Mountain, Celestial Artifact Sect, and Heavenly Sword Mountain also took to the offense and dealt the Heaven Ghoul clansmen a severe blow.

Led by Xu Ran and Lei Yan, Terminator Sect slaughtered many young and old Heaven Ghoul clansmen at Prism Continent.

The battle of the Setting Sun Islands, the seriously wounded Bhutto, the death of Lucas and the fall of several Soul Altar experts meant that the three ghoul races could no longer dominate this land any longer.

A few days later.

Many war chariots, giant ships, and flying spirit artifacts returned to the Setting Sun Islands from the surrounding sea regions.

Qin Lie, Song Tingyu, Du Xiangyang, and others also returned to the islands calmly while riding on a Flowing Gold Fire Phoenix.

After pursuing after the Blue Ghoul Race and Earth Ghoul Race for a couple of days straight, at least two thirds of the ghouls had eternally sunk into the deep sea.

Andrew of the Earth Ghoul Race was hunted down and killed by Hark, Eddie, Yuria, Tang Beidou, Tang Miao, Lu Yi, and Yu Lingwei.

Linton of the Blue Ghoul Race was also pummeled by Jin Dao, the eight god corpses, Miao Fengtian, and two Corpse Demons until his soul was pletely extinguished.

Bergson, Barham, and a small number of Soul Altar experts were the only ones who managed to escape by luck using their race’s escape art.

The shadow the three ghoul races had cast upon the Land of Chaos was swept clean in one single battle.

“The ghoul races are no longer a threat after this battle is over.” Song Tingyu smiled while saying, “Terminator Sect, Heavenly Sword Mountain, Ten Thousand Beast Mountain, and Celestial Artifact Sect are all attacking the three ghoul races. Even Black Voodoo Cult and the three great families are slaughtering the Blue Ghoul clansmen who were left behind in Illusory Demon Sect. Judging from the current situation, the three great ghoul races will not be able to do anything other than run for their lives from here on out. They have no other choice because they will be attacked by everyone the second they reveal themselves. Their destruction is set in stone thanks to our great victory.”

Luo Chen, Du Xiangyang, and the others wore relaxed expressions on their faces too. From this battle, they learned that Flaming Sun Island had truly emerged as an unstoppable force in the Land of Chaos.

From this day onwards, no other force could suppress Flaming Sun Island’s brilliance any longer.

Both men couldn’t help but feel a bit conflicted when they looked at Qin Lie beside them. Their emotions only deepened when they thought of the time they first met Qin Lie.

They could never imagine that Qin Lie, a mere Netherpassage Realm martial practitioner at the time, could create Flaming Sun Island and bring it to such heights in less than ten years.

“Are you free to talk about some future matters, Qin Lie?” Mo Lingye asked loudly with a smile from Blood Fiend Sect’s flying spirit artifact.

“Why don’t we talk at Flaming Sun Island later?” Qin Lie answered.

“Alright.” Mo Lingye nodded.

The Blood Fiend Ten Elders—Mo Jun, Hong Bowen and Meng Feng—the cool Xue Moyan, and Illusory Demon Sect martial practitioners such as Yu Lingwei were standing beside her.

“I heard that Wen Bin and Chu Miaodan had returned to Illusory Demon Sect openly after the ghouls occupying Illusory Demon Sect had been taken out by Black Voodoo Cult and the three great families. Sigh…” Yu Lingwei let out a soft sigh.

“How absolutely shameless!” Xue Moyan said coldly.

They had heard the news of Black Voodoo Cult seizing the opportunity to reestablish themselves at Illusory Demon Sect after the three ghoul races had been defeated.

Wen Bin still called himself the sect master of Illusory Demon Sect as he sent order for all surviving Illusory Demon Sect disciples to return to their sect.

“Wen Bin had probably obtained Jiang An’s support,” Mo Jun criticized disdainfully. “Illusory Demon Sect and Black Voodoo Cult have always been sworn enemies with each other, and it’s not like Black Voodoo Cult has just recently set their sights on Illusory Demon Sect’s territory. It was already shameful enough of them to submit to Black Voodoo Cult after Illusory Demon Sect was destroyed, but they actually dare to retake Illusory Demon Sect for themselves after our great victory, and with Jiang An’s help no less. The word ‘shame’ seriously doesn’t exist in their dictionaries.”

“Big Brother Xue hasn’t returned yet, so Old Mo and Sect Master Yu are the only Soul Altar experts we possess right now,” Hong Bowen said seriously. “Our current strength is pletely insufficient to chase them away.”

They all guessed that Wen Bin must’ve obtained Jiang An’s support.

Not only did Jiang An represent Black Voodoo Cult itself, he was capable of manding the three great families. This bined force wasn’t something they could fight against.

“If Qin Lie was willing to lend us a helping hand, then we would have the strength to chase Wen Bin and the others out of Illusory Demon Sect. Otherwise… it will not be easy,” Mo Lingye said.

“Mn. Qin Lie must give us the nod, or no one can help you,” Meng Feng also said.

Everyone thought that Qin Lie’s permission was necessary for Yu Lingwei to reclaim her identity as Illusory Demon Sect’s sect master.

“Sigh, Illusory Demon Sect had offended him quite badly back then. I’m just afraid that…” Yu Lingwei looked deeply worried.

“What are you afraid of? Are you afraid that he will refuse to help?” Mo Lingye looked surprised. “The people who offended him are Ji Qingpeng, Wen Bin, and Chu Miaodan. You’ve never clashed against him from the start to the end, have you? What are you worried about?”

“I do think that he’ll help us, it’s just… I’m worried that he will seize the opportunity to claim Illusory Demon Sect’s territory for himself.” Yu Lingwei smiled wryly. “Once this war is over, the three great families may never be able to return to the Heavenly Calamity Continent. You have Xue Li, and Jiang Zhuzhe’s force is just as scary. Barring any surprises, Blood Fiend Sect is destined to return to the Heavenly Calamity Continent. As for Flaming Sun Island… they have already brandished their strength. In fact, a small place like Flaming Sun Island may not necessarily be able to contain him, and it so happens that the closest territory next to his island is the overthrown Illusory Demon Sect.”

“You’re afraid that he’ll take over Illusory Demon Sect’s territory, as is his right to do so?” Mo Lingye finally came to realization.

Yu Lingwei nodded helplessly. “I cannot stop him if he really does that. Wen Bin and those people… may have no choice but to give in as well.”

“I see…” Mo Lingye thought for a moment before sighing. “A human heart is unpredictable. I don’t know what he’s thinking either. Let’s just head to Flaming Sun Island later and check out his intentions.”

“I suppose that is the only thing we can do,” Yu Lingwei said.

An hour later.

After returning to Flaming Sun Island, Qin Lie summoned all core members of the group such as Lang Xie, Mo Hai, Tang Siqi, Lu Yi, and so on.

“Blood Fiend Sect will be ing soon.” Song Tingyu looked at everyone before saying, “They’ll probably talk about profit distribution.”

Qin Lie pondered for a moment before saying, “Three years ago, I’ve already had a tacit understanding with Jiang Zhuzhe and Xue Li to eliminate the three great families at the Heavenly Calamity Continent together. At the time, the three ghoul races weren’t as strong as they were recently. We’ve already talked about this briefly at the time. The territory belonging to the three great families at the Heavenly Calamity Continent will be returned to Jiang Zhuzhe, whereas Blood Cloud Mountain Range and other Blood Fiend Sect territories will be returned to Xue Li and the others. The two separate lineages of Blood Fiend Sect will share the Heavenly Calamity Continent together.”

“What about us?” Lang Xie asked.

“The islands where Blood Fiend Sect is settled at will be returned to us. The hundred or so islands next to us such as Gold Sun Island, Heavenly Sea Pavilion, the Pan Family, Black Cloud Palace will bee our property as well,” Qin Lie said.

“Illusory Demon Sect of the Heavenly Slaughter Continent was destroyed, so there are a lot of free territories to claim over there,” Feng Rong said.

“I just got wind that Wen Bin had taken out the Blue Ghoul clansmen occupying Illusory Demon Sect and reentered the domain with Black Voodoo Cult’s aid,” Song Tingyu said.

Feng Rong smiled and looked at Qin Lie. “With your current strength, forget that Illusory Demon Sect had just changed sect masters, we can even invade Black Voodoo Cult if that is your wish, island master.”

Everyone smiled and grew relaxed when they heard this.

“The Dark Shadow clansmen won’t be staying at the Land of Chaos for long.” Qin Lie frowned. “When the three ghoul races are pletely eliminated, they will leave. When that happens… Flaming Sun Island will still have to develop itself.”

“They’re leaving?” Mo Hai looked surprised.

“Yes, they’ll definitely leave one day.” Qin Lie thought for a moment before saying, “I have a tentative plan in mind.”

The group stopped discussing and looked at him.

“My agreement with Jiang Zhuzhe and Xue Li is for them to share the Heavenly Calamity Continent while we claim the hundred or so islands around the Setting Sun Islands. While the Dark Shadow clansmen are still around, we should help Yu Lingwei retake Illusory Demon Sect and force Black Voodoo Cult into a war against us. We will do everything we can to reduce Black Voodoo Cult and the three great families’ strength.” Qin Lie said solemnly, “We need to make sure that there are no forces that can threaten us after the Dark Shadow clansmen have left. In the future, we need to make ourselves stronger. With our current strength and reputation in the Land of Chaos, we don’t need to rely on anyone to grow stronger.”

“That works too.”

“It is true that our foundation is shallow. There’s nothing wrong with taking things one step at a time.”

Everyone agreed with his suggestion.

A while later, Mo Lingye, Yu Lingwei, Xue Moyan, Hong Bowen, and Mo Jun arrived.

“Qin Lie, she is Yu Lingwei, the former sect master of Illusory Demon Sect and my sworn sister.” Mo Lingwei pointed at Yu Lingwei before saying, “She is the one who has been taking care of us in secret ever since Blood Fiend Sect was destroyed by the great forces. Therefore, I cannot do nothing while Illusory Demon Sect is in danger. I believe you’ve heard the news of Wen Bin retaking Illusory Demon Sect for himself. Although I wish to help her retake Illusory Demon Sect, my force’s strength alone is insufficient. I hope that…”

She looked expectantly at Qin Lie.

Xue Moyan’s cool pupils were filled with askance too. She said, “Master has taken care of me at Illusory Demon Sect since young. Please help us, Qin Lie.”

“That is not a problem.”

Qin Lie agreed immediately.

Mo Lingye and everyone showed joy on their faces, but a hint of worry still colored their faces. They were afraid that Qin Lie might claim some of Illusory Demon Sect’s territories for himself.

Qin Lie continued, “Just like we had agreed on earlier, you will share the Heavenly Calamity Continent with Jiang Zhuzhe while we will lay claim to the islands surrounding the Setting Sun Islands such as Heavenly Sea Pavilion, Black Cloud Palace, the Pan Family, Gold Sun Island and so on. I won’t take anything from the Heavenly Slaughter Continent or the territories of Illusory Demon Sect either.”

Everyone in Blood Fiend Sect and Illusory Demon Sect was overjoyed to hear this.

They never imagined that Qin Lie could be this generous.

When they came to an agreement with Qin Lie and Jiang Zhuzhe before, Qin Lie didn’t have these terrifying Dark Shadow clansmen backing him up yet. That was why they had split their profits as appropriate to Flaming Sun Island’s strength at the time.

However, after Qin Lie was backed up by those Dark Shadow Race experts, his strength had increased by several times since the time they made the agreement.

It was entirely in his right to ask for a bigger share of the profits.

Yu Lingwei and Mo Lingye had even agreed privately to give up half of Illusory Demon Sect’s territory to Flaming Sun Island.

That wasn’t all. Mo Lingye herself was considering negotiating with Jiang Zhuzhe to give up a piece of land to Qin Lie.

No one imagined that Qin Lie would obey their original deal.

“Island Master Qin, Illusory Demon Sect will never forget today’s kindness for as long as we exist!” Yu Lingwei said solemnly.

“Qin Lie, without you, Blood Fiend Sect may not be able to return to Blood Cloud Mountain Range even if another one thousand years were to pass by.” Mo Lingye sighed.

She knew very well that Qin Lie was the one who released Xue Li from his shackles and gifted him the Blood Progenitor’s remains along with the seven-level Soul Altar.

When the three great families and Black Voodoo Cult planned to eliminate Blood Fiend Sect, it was also Qin Lie who protected Blood Fiend Sect with the aid of Duan Qianjie.

Today, Qin Lie again generously allowed Blood Fiend Sect to reclaim the entire Heavenly Calamity Continent for themselves.

You are reading Spirit Realm Chapter 938: Being Generous on novel69. Use the chapter navigation above or below to continue reading the latest translated chapters.
Share with your friends
Library saves books to your account. Reading History saves recent chapters in this browser.
Continuous reading

You may also like

The Purgatory Calamity cover
Same author

The Purgatory Calamity

Ni Cang Tian ·Eastern

TheyoungPangJianwasforcedtoascendtotheheavens. …… ps:ThisisNiCangtian’snewworkafter“GodOfSlaughter”and“SpiritRealm”. Source:Webnovel.com,updatedonN...

God of Slaughter cover
Same author

God of Slaughter

Ni Cang Tian ·Action

Growingupparentless,ShiYan,whowasleftwithalargeinheritancemoney,boreageneraldisinterestinlife. Theonlytimeshefeltalivewaswhenadrenalinecoursedthoro...

No reviews yet. Be the first reader to leave one.
Please create an account or sign in to post a comment.