Font Size
15px

Chapter 916: Turn of Face

Jiang Zhuzhe had never been a good person.

Since the very beginning of his career, he was acpanied by bloody storms. In the end, he upended the entire Land of Chaos.

A thousand years ago, Blood Fiend Sect which dominated the Heavenly Calamity Continent was attacked by the entire cultivation world because he stepped onto an evil path and cultivated the Blood Spirit Art using human blood.

Because of him, Blood Fiend Sect was destroyed.

He himself managed to escape, hiding among the eastern barbarians as he made more waves. He secretly schemed for the Trial of the Graveyard of Gods and successfully obtained the remains of many ancient elites.

Due to this, his strength skyrocketed.

Many years later, he reached the Imperishable Realm and showed himself in public again, entering the Ruined Lands to announce his return to the world.

Black Voodoo Cult and the three families had all tried to kill him in the past with all of their power. But since he now possessed a three-level Soul Altar, they suddenly became silent.

This showed just how terrifying a person he was.

Partnering with a person like this was to scheme with a tiger. If one was not careful, they would die.

"You used us to open the barrier to the Shadow Earth Palace." Qin Lie's expression was dark.

Jiang Zhuzhe smiled and did not conceal anything. He admitted honestly, "The boundary that Li Xin formed in the past was destroyed in two months by the Earth Ghoul Race. The inner layer that Calvert formed using the power of a rank nine evil dragon has been slowly eroded by the Earth Ghoul Race with a hundred thousand wraiths. It is almost broken."

"If I cannot enter the Shadow Earth Palace before the Earth Ghoul Race, I will not be able to absorb the blood of this rank nine evil dragon."

"For me, using Gilbert to enter was the fastest and most direct method."

He smiled and looked at Calvert, saying, "You were heavily injured by the first sect master of Blood Fiend Sect and were then sealed into the Shadow Earth Palace. You were unable to leave so you couldn’t recover."

"Recently, the Earth Ghoul Race has used a hundred thousand human souls to devour the barrier. You used your energy to restore its energy, you must have expended most of it?"

Calvert's enormous eyes hid a plicated gaze. The pressuring aura he released was quickly retracted.

In an instant, Calvert's dragon body no longer had a terrifying aura.

"Lord Calvert? You... you were really bluffing?" Gilbert was shocked.

This rank nine evil dragon's bearded face showed a helpless expression.

"He is right. After I was wounded by Li Xin I was unable to leave and recover. No one could open the barrier and provide me with necessary energy."

"In these years, people have repeatedly tried to break into the Shadow Earth Palace. I have been expending my power to stop them."

"This time, the invasion of the Earth Ghoul Race's hundred thousand wraiths has almost used up all of my power. I am a rank nine evil dragon but I am almost at the end of my rope."

Jiang Zhuzhe had an accurate assessment of his situation and Calvert knew he could not conceal it. He had to preserve his remaining power to face Jiang Zhuzhe, who was a great threat. He would not waste power on his aura.

He was prepared to fight to the end.

"You treat your allies like this?" Qin Lie shouted.

Jiang Zhuzhe smiled and said calmly, "I only want this rank nine evil dragon. Other than him, the remaining evil dragons in the Shadow Earth Palace, and even the corpses of the True Dragon Country’s imperial family, I can give up all of them."

"You will not give up?" Qin Lie's eyes were dark.

Shaking his head, Jiang Zhuzhe sighed and said, "The Land of Chaos is vast, but I really cannot find anything else that will let me advance quickly."

"I can help you find something like the rank nine evil dragon in another domain!" Qin Lie said irritably.

Jiang Zhuzhe smiled slightly and said, "I know my limits. With my three-level Soul Altar strength, I will not be a match for people of that level. Bhutto of the Heaven Ghoul Race is an early Void Realm expert. If I can kill him and drink his blood, maybe I have a hope of advancing. Pity... I am definitely not a match for him."

"Only this extremely weak evil dragon is my chance. He is also my only chance. Do you think I will give it up?"

Qin Lie's anger was about to erupt like a volcano.

"Qin Lie, I have a high opinion of you so I will not kill you. After this matter, if I reach the Void Realm through this rank nine evil dragon, I will still kill the three ghoul races, the three families and Black Voodoo Cult according to our agreement." Jiang Zhuzhe was undisturbed. "I only act against events, not people. In order to reach the Void Realm, this evil dragon must be sacrificed."

As he spoke, he walked towards Calvert.

At the same time, an enormous wheel that looked like a bloody sun and flashed with eerie bloody energy suddenly appeared above his head.

"Blood Drinking Wheel!" Qin Lie's expression suddenly changed.

This bloody wheel hung above Jiang Zhuzhe's head. As Jiang Zhuzhe moved, it moved and released rays of blood.

In this moment, the entire Shadow Earth Palace was illuminated by the bloody red light. An aura that could make blood uncontrollable and the soul feel as though it was immersed in a sea of blood covered every inch of the palace.

"Jin Dao, Brother Miao, do not release your Soul Altars. Qin Lie's Spirits of Void and Chaos are destructive against Soul Altars."

"Just keep Qin Lie and the two friends he brought along docile, do not kill them."

Jiang Zhuzhe said as he walked.

Jin Dao nodded respectfully and then grinned viciously. He said to Qin Lie, "Island Master Qin, I will offend you greatly this time, please forgive me."

Pu Ze and the White Bone Demon Monarch, the two Corpse Demons, suddenly howled, their hair standing on end like needles.

Along with the howl, a thick tang of blood exploded out of the two Corpse Demons.

Circles of blood rippled outwards like bloody water from a bloody sea.

As the corpse energy and blood energy mixed, the aura of the two Corpse Demons was even more terrifying than before.

As Gilbert howled and transformed, the Corpse Demon Pu Ze tore apart the air.

Eddie's expression changed. Then, he saw the White Bone Demon Monarch Corpse Demon stride over holding an enormous white bone blade.

That white bone blade was almost three meters in length as it cut along the ground. It drew out a long and narrow gully in the hard ground of Shadow Earth Palace.

Two pale flames burned in White Bone Demon Monarch's eyes like flames of death.

"Island Master Qin, if you can control them, have them not act, then... we and the Corpse Demons will not have to use force." Jin Dao looked at Qin Lie sincerely. "Honestly, even if you fight, you will not change anything in Shadow Earth Palace, how about standing aside?"

"Jiang Zhuzhe, if you dare to act against this rank nine evil dragon, I will have Void Realm experts destroy your soul after this!" Qin Lie shouted.

Jiang Zhuzhe who was walking towards Calvert paused upon hearing this and looked back at him. He smiled and said, "Qin Lie, you are too innocent, if you had really brought along the Void Realm expert from the Dark Shadow Race this time, then I would have only taken the ancient corpses of the True Dragon Country's Imperial family."

"Haha, but threatening me with a Void Realm is useless right now, because when I drink the blood of this rank nine evil dragon, I will have a high likelihood of entering the Void Realm."

"Once I, Jiang Zhuzhe, enter the Void Realm, who will I fear in this Land of Chaos?"

He laughed.

"Move aside!"

Gilbert had turned back into his evil dragon form. When the Corpse Demon Pu Ze came, he waved his claws as he spat out green flames.

The dragon flames contained a terrifying corrosive poison.

A dragon claw like an enormous anchor flashed with cold light as it swiped towards Jiang Zhuzhe's small figure.

"Heavenly Blood Web." Jiang Zhuzhe pointed above his head.

The Blood Drinking Wheel, the ultimate treasure of Blood Fiend Sect, immediately expanded to ten times its original size, spinning as it shot out thousands of blood rays.

The blood rays formed an enormous net of blood in the air, shook as though it was fishing, and then caught Gilbert.

Gilbert's enormous body was like a fish in an even bigger net. He furiously struggled but he could not break out.

Jiang Zhuzhe easily avoided the green flames as he dodged.

"Will you fight?" Eddie looked at Qin Lie.

Gilbert was trapped and unable to break free. The Corpse Demon Pu Ze, who had been heading towards Gilbert, turned under Jin Dao's direction towards him.

Other than the two Corpse Demons, there was Jin Dao and also Miao Fengtian who had received the inheritance of the Corpse Progenitor.

With Eddie's experience and intelligence, this situation had no hope of victory. He felt that Qin Lie would first endure this, and then settle the score with Jiang Zhuzhe later.

Yet Qin Lie took out the Thunder Soul Blade without a word and summoned the six Spirits of Void and Chaos.

He used his actions to answer Eddie.

You are reading Spirit Realm Chapter 916: Turn of Face on novel69. Use the chapter navigation above or below to continue reading the latest translated chapters.
Share with your friends
Library saves books to your account. Reading History saves recent chapters in this browser.
Continuous reading

You may also like

The Purgatory Calamity cover
Same author

The Purgatory Calamity

Ni Cang Tian ·Eastern

TheyoungPangJianwasforcedtoascendtotheheavens. …… ps:ThisisNiCangtian’snewworkafter“GodOfSlaughter”and“SpiritRealm”. Source:Webnovel.com,updatedonN...

God of Slaughter cover
Same author

God of Slaughter

Ni Cang Tian ·Action

Growingupparentless,ShiYan,whowasleftwithalargeinheritancemoney,boreageneraldisinterestinlife. Theonlytimeshefeltalivewaswhenadrenalinecoursedthoro...

No reviews yet. Be the first reader to leave one.
Please create an account or sign in to post a comment.