Spirit Realm Chapter 1803: Reborn

Novel: Spirit Realm Author: Ni Cang Tian Updated:
Font Size
15px

Lieyan Yuan’s flames burned brightly and fiercely. They obviously contained many different powerful laws of fire.

However, Qin Lie was pletely unaffected by the flames. He was able to fly through them unharmed.

One of his purple eyes slowly turned crimson. An aura equal to the flames around him burned inside his bloodline.

“Sizzle!”

Fire started spilling out of his pores as well. Qin Lie grinned and made a grabbing motion.

The Flame Devil King's life crystal was instantly summoned from Flaming Sun Purgatory and entered his palm.

Dense fiery patterns immediately appeared on the rock’s surface the moment it entered the sea of fire.

Every pattern represented a law of fire!

“Qin Lie!”

Lieyan Yuan called out from the heart of the fire.

Fire was literally leaking out of his eyes like lava.

He watched the approaching Qin Lie closely, and the latter stopped about a thousand meters away from him.

Countless fiery patterns filled up the space between Qin Lie and Lieyan Yuan. They represented the deepest secrets of the power of fire.

These fiery patterns were something Lieyan Yuan had created by studying the ultimate power of fire.

One might call the sea of flame Lieyan Yuan’s unique domain.

“Flame World!”

Perhaps Qin Lie’s approach had alarmed Lieyan Yuan’s perception, as he immediately let out a snort and unleashed his full power at Qin Lie.

The fiery energy around him suddenly exploded without warning.

A terrible storm of fire from the countless explosions lit up the void.

Controlled by Lieyan Yuan’s bloodline, the fire storms gathered around the old man.

Qin Lie frowned slightly at the sight of this.

It took only one probe to discover that the fire storms contained enough fire energy to destroy entire realms.

Moreover, Lieyan Yuan’s body of flame looked like the culmination of all the laws of fire in the world. It looked like it was capable of burning even Spirit Realm and God Realm to ashes.

“It’s been thirty years. I didn’t think you would remember me.”

The fire shrouding Lieyan Yuan’s face faded when he started speaking.

The true face behind the boiling flames was revealed. Lieyan Yuan stared coldly and enigmatically at Qin Lie.

Sparks suddenly appeared outside his pupils and circulated according to some unusual laws.

“Hmm?”

Surprised, Qin Lie quickly realized that billions of fiery sparks were flooding toward him. They looked like the stars of a universe.

“Crack crack!”

The sound of something being crushed came from all around him. He sensed danger from this attack.

Qin Lie abruptly recalled that Lieyan Yuan was also an expert in the power of space.

“Spatial Restoration.”

The multifaceted Galaxy Mirror in his other hand shone as brightly as the stars.

Starlight flew in from everywhere and surrounded him in no time.

The breaking space around him was mended in just the blink of an eye.

Qin Lie moved his shoulder slightly, and layers of blue space came to life from his bloodline.

The spatial layers surrounded him tightly and protected him from Lieyan Yuan’s attack.

“Who would’ve thought you would bee this powerful in just thirty years,” Lieyan Yuan said ruefully.

His power reached a whole new level after trying to enter the ultimate realm. He was sure that he had surpassed Tian Qi.

He thought he would be able to kill Qin Lie easily like this.

However, he hadn’t considered the possibility of Qin Lie growing to nine thousand and nine hundred meters tall after killing Castor, absorbing his dead soul power and the blood essences of hundreds of races.

He knew full well that a Great Lord of the Abyss at this height was one step away from being the Abyss Master.

This meant that Qin Lie’s true power wasn’t inferior to his own, even though he was just one step away from entering the ultimate realm.

That was why he decided to treat this carefully.

“You wish to take the final step?” Qin Lie asked indifferently.

“What? You want to stop me?” Lieyan Yuan said with a snort.

Qin Lie frowned in silence for a moment before answering, “I’m not just here to stop you, I’m here to kill you once and for all.”

“Heh!” Lieyan Yuan let out a chuckle. “I can’t believe you’re actually taking over the Imperial Soul Monarch’s role of stopping anyone who wishes to enter the ultimate realm. Unfortunately, you’re not the Imperial Soul Monarch, and unlike him, you’re not familiar with the wonders of the ultimate realm. You may be nine thousand and nine hundred meters tall, but you’re ultimately not an Abyss Master. The current you doesn’t have enough power to stop me!”

“Is that so?” Qin Lie smiled coolly at Lieyan Yuan before shaking his head. He said,“I don’t think so.”

“Rip!”

Another spatial rift suddenly appeared next to them. It was none other than the vanished Tian Qi.

“Tian Qi!” Lieyan Yuan let out a growl.

Surprised, Qin Lie turned to look at the old man who had severed his relations with the Spirit Race. He asked, “Why are you here? Don’t tell me you’re here to protect him?”

Tian Qi shook his head bitterly and said, “I just came here to check because I sensed a disturbance in space. I’m not plotting anything.”

Qin Lie nodded and said, “Good. Otherwise…”

Tian Qi’s smile grew even more bitter. “I knew it would be like this.”

“What are you talking about?” Lieyan Yuan asked in puzzlement.

“Don’t you understand yet?” Tian Qi sighed and shot Lieyan Yuan a deep look. He said, “The Soul Race’s Soul Suppressing Orb is in Qin Lie’s hands. It fused with Qin Lie a long time ago.”

“What!” Lieyan Yuan exclaimed in shock.

“I secretly went to the abyss passageway when Castor was killed. It was then I heard something… interesting.” Tian Qi sucked in a deep breath and turned toward Qin Lie. He said, “Castor’s main soul was planning to mit suicide and drag your soul with him, but he didn’t succeed in the end. It was because his eight subsouls suddenly lost all contact with their main soul. No matter how I think about it, the only thing in the world that could severe the soul connection between Castor’s main soul and subsouls was the Soul Race’s sacred relic. Even better, this sacred relic has been forged by the Imperial Soul Monarch.

“Which means it’s his lifeblood artifact.””

“What are you saying?” Lieyan Yuan still didn’t understand the implications behind Tian Qi’s explanation.

“Qin Lie came to stop you just like the Imperial Soul Monarch had stopped Castor, and all the experts in the universe!” Tian Qi hinted.

But Lieyan Yuan still looked confused.

“Oh, Lieyan Yuan, don’t you understand yet? Your years of study resulted in the creation of the Perfect Blood, but it isn’t just you who should be credited for the success.” Tian Qi said while sighing, “If it was, you should’ve been able to recreate the Perfect Blood again after Qin Lie, right?”

“Qin Lie’s existence and the creation of the Perfect Blood wasn’t a coincidence at all.”

“I’d spent the past thirty years hiding myself and searching for information. I found out that the first Qin Lie had perished a long time ago.”

“That means that the Qin Lie standing before you and I is actually the reborn Imperial Soul Monarch!”

You are reading Spirit Realm Chapter 1803: Reborn on novel69. Use the chapter navigation above or below to continue reading the latest translated chapters.
Share with your friends
Library saves books to your account. Reading History saves recent chapters in this browser.
Continuous reading

You may also like

The Purgatory Calamity cover
Same author

The Purgatory Calamity

Ni Cang Tian ·Eastern

TheyoungPangJianwasforcedtoascendtotheheavens. …… ps:ThisisNiCangtian’snewworkafter“GodOfSlaughter”and“SpiritRealm”. Source:Webnovel.com,updatedonN...

God of Slaughter cover
Same author

God of Slaughter

Ni Cang Tian ·Action

Growingupparentless,ShiYan,whowasleftwithalargeinheritancemoney,boreageneraldisinterestinlife. Theonlytimeshefeltalivewaswhenadrenalinecoursedthoro...

Big Data Cultivation cover
Similar genre

Big Data Cultivation

Chen Fengxiao ·Fantasy

Asagraduatewithadoubledegreefromaprestigiousuniversity,FengJunsomehowremainsunemployedaftergraduation.Hestrugglesinthecity,buthecan’tletgoofhisprid...

No reviews yet. Be the first reader to leave one.
Please create an account or sign in to post a comment.