Font Size
15px

“Get out of my way!”

Castor stared at the Great Lords of the Abyss above his head with the same coldness and disgust he treated the seven Devil Monarchs with.

In his opinion, these Great Lords of the Abyss were even less worthy of his attention than the seven Devil Monarchs. They had been obedient subordinates who wouldn’t even dare breath loudly in his presence back then.

He had been the Abyss Master after all.

“Whoosh whoosh!”

The horde of rank ten Great Lords of the Abyss actually gave way after Castor shouted angrily at them.

A path leading straight to the top opened just like that.

These Great Lords of the Abyss would rather push themselves against the cramped walls of the abyss passageway than disobey a direct order from Castor.

It was proof that Castor’s authority still lingered to this day!

The seven Devil Monarchs led by Auston were the only ones who ignored his order and maintained their positions. They were all staring at Qin Lie with urgent looks in their faces.

They were all wishing for Qin Lie to attack Castor again.

However, the man who bore their expectations was struggling internally.

“Are you going to stop me?”

Castor didn’t want to make himself look too weak in front of an audience, so he turned to stare coldly at Qin Lie instead of leaving right away.

“Zzzt!”

A dot of dark purple light flashed from inside Qin Lie’s Soul Altar.

When Qin Lie paid attention to it, he noticed that the purple crystal fused to his Soul Altar was growing restless again.

A strange wave of activity was ing from inside the dead soul domain. It indicated that Castor’s domain was growing more and more unstable.

If he allowed this to go on, it would only be a matter of time before the domain shattered.

When that happened, the explosion would destroy his Soul Altar as well!

Without his Soul Altar, he couldn’t maintain his Abyss Devil form. He couldn’t even be a Devil Monarch or maintain his current level of power.

His Soul Altar was closely tied to Flaming Sun Purgatory too. The destruction of his Soul Altar might very well lead to the destruction of Flaming Sun Purgatory itself.

He would immediately lose the throne that made him a Devil Monarch in the first place!

“Should I let him go? Or not?”

He gritted his teeth tightly as he tried to think of a solution.

His anxiety also made his bloodline unusually restless.

“Hooo!”

Qin Lie breathed heavily as his struggle continued. Sometimes he looked like he could murder Castor on the spot, and sometimes he looked so calm it was unnerving.

The horde of Great Lords of the Abyss gathered around here didn’t understand what was going on, but they all noticed something was wrong with Qin Lie.

Even the seven Devil Monarchs had decided to stay silent and let him think in peace.

Everyone had a feeling that Qin Lie’s decision would affect the entire Abyss!

That was why they decided to wait for Qin Lie to e to a conclusion.

“Heh. Can you harden your determination and make the necessary sacrifice?” Castor said coldly.

He looked rather relaxed because the pressure wasn’t on him.

“I absolutely must think of a way to take out Castor’s main soul!” Qin Lie shouted in his own mind.

“Whoosh!”

Suddenly, the Soul Suppressing Orb inside his forehead stirred as if it had heard his soundless cry.

Surprised, Qin Lie’s astonishment grew when the Soul Suppressing Orb suddenly swam toward his Soul Altar.

He suddenly closed his eyes and focused on sensing the Soul Suppressing Orb with his soul consciousness.

In a flash, the black light that was the Soul Suppressing Orb flew toward the purple crystal and entered the dead soul domain.

“Zzzt!”

The purple sparks spilling off the surface of the purple crystal abruptly disappeared.

When Qin Lie’s soul consciousness tried to enter the domain, he was surprised to find that he was blocked outside.

Without entering the world of dead souls, there was no way for him to check what was going on between the Soul Suppressing Orb and Castor’s main soul.

However, he could sense his Soul Altar being unnaturally stable after the Soul Suppressing Orb had entered the scene.

It almost felt like the destruction of Castor’s main soul could not affect his Soul Altar anymore!

When the shock had passed, the huge rock inside Qin Lie chest suddenly disappeared.

He abruptly turned to look at Castor.

There was a clear look of puzzlement and confusion in his eyes.

Countless bits of dark light swam inside Castor’s Abyss Devil pupils. It looked like he was executing some sort of soul art.

However…

“What’s going on? What did you do? W-why have I lost contact with my main soul?!”

Castor shouted in shock as even more soul imprints appeared from his pupils before extinguishing rapidly.

The soul imprints were a secret art that connected him to his main soul. But they all disappeared into nothing, and he wasn’t able to connect to his main soul at all!

His eight subsouls and his main soul had never been separated. They had always been on the save wavelength until now.

Even when Qin Lie was at Spirit Realm, and the avatars were still in the Abyss, he was still able to sense his main soul and conspire together.

But now, Qin Lie was right in front of him, but he wasn’t able to sense his main soul at all!

It was something that had never happened before!

“You can’t reach your main soul?” Qin Lie exclaimed in surprise.

He didn’t know what happened after the Soul Suppressing Orb had entered the purple crystal, but he did know that his Soul Altar had returned to normal.

It seemed like his Soul Altar would remain stable as long as the Soul Suppressing Orb was inside the dead soul domain. His Soul Altar was probably safe even if the domain were to explode now.

This meant that Castor could no longer threaten him!

“Screw it!”

Qin Lie finally shedded his hesitation and gripped the Galaxy Mirror tightly.

“Go!”

The Demon Spirit of Space and Time Race’s sacred relic, the Galaxy Mirror, transformed into a sea of stars and attacked Castor as if it had been charged with eons of hatred and anger of their race.

“The Flaming Sun Monarch has acted!”

“Is this it? Is this the final battle?”

“Whoever wins this will probably bee the new Abyss Master, right?”

All the Abyss Devils grew excited when Qin Lie finally took action. They automatically moved further away from the duo and watched from afar.

“Swhoosh swhoosh!”

Millions of starlight flew out of countless black holes and plunged into Castor as light droplets or spatial blades.

At the same time, the Galaxy Mirror swelled bigger before shining layers of space into existence.

The layers of space containing mysterious spatial laws and powers immediately wrapped around Castor.

Auston and the rest of the seven Devil Monarchs were about to rush in to help Qin Lie, but something they saw suddenly froze them in their tracks.

It was because Castor’s body was separated into several parts by the layers of space.

Right now, Castor’s head was trapped in an independent space, his limbs were pletely separated, and even his legs seemed to have been separated from the rest of the body.

“My bloodline, my bloodline is dispersing, I can’t circulate it properly…” Castor exclaimed in shock.

Somehow, the layers of space were pulling apart his connection to his own bloodline.

However, the endless rain of stars were pletely unaffected by the layers of space. They struck his split body instantly and caused splatters of flesh, bone and blood everywhere.

The attack had wounded him almost immediately.

“It’s that bastard’s dying will!”

He could sense the dead patriarch’s aura from the stars and space all around him.

He abruptly realized that the most powerful Demon Spirit of Space and Time he thought he had exterminated had imbued his soul consciousness into the Galaxy Mirror. He had been waiting for this moment for millions of years!

You are reading Spirit Realm Chapter 1794: Lingering Authority! on novel69. Use the chapter navigation above or below to continue reading the latest translated chapters.
Share with your friends
Library saves books to your account. Reading History saves recent chapters in this browser.
Continuous reading

You may also like

The Purgatory Calamity cover
Same author

The Purgatory Calamity

Ni Cang Tian ·Eastern

TheyoungPangJianwasforcedtoascendtotheheavens. …… ps:ThisisNiCangtian’snewworkafter“GodOfSlaughter”and“SpiritRealm”. Source:Webnovel.com,updatedonN...

God of Slaughter cover
Same author

God of Slaughter

Ni Cang Tian ·Action

Growingupparentless,ShiYan,whowasleftwithalargeinheritancemoney,boreageneraldisinterestinlife. Theonlytimeshefeltalivewaswhenadrenalinecoursedthoro...

No reviews yet. Be the first reader to leave one.
Please create an account or sign in to post a comment.