Font Size
15px

Chapter 1305: The War Ahead of Time?

Frost Desolation Abyss.

Qin Lie's Soul Beast avatar used its bloodline latent ability Dark Soul to hide its powerful soul and move through the teleportation formation on the White Bone Nether Spirit Altar.

The reason he did so was because Great Lord of the Frost Desolation Abyss was paying more attention to area under Cadak’s jurisdiction, at least in name.

To avoid unnecessary trouble, his Soul Beast avatar was always very careful every time he moved through this place.

The Soul Beast avatar was at rank nine, and even though it had the Dark Soul bloodline ability, it could not guarantee discretion under full power search of the Great Lord of the Abyss.

Of course, the Great Lords of the Abyss would spend majority of their time prehending their respective levels’ natural laws.

Their souls would only roam around the areas they controlled when they had time to spare.

As long as it was not during that spare time, the Soul Beast avatar was relatively safe after using Dark Soul, and would not attract attention of the Great Lords of the Abyss.

There were too many similarities between his main body and his avatar. If the Great Lord of the Abyss actually saw the True Soul presence of his Soul Beast avatar, they might discover the truth.

Then, the Great Lord of the Abyss would most likely personally e over for a discussion.

This was not want he wanted.

Enos's father already knew that his main body had many secrets and took great interest in him.

After the battle in the Origin World, Enos would have told her father even more. That would only strengthen his interest.

Especially after he’s refined the Origin Crystal.

It was never good when the Abyss Devils targeted the weak. He had to avoid contact as long as possible..

Therefore, each time his Soul Beast avatar came, he would be very careful and would not stay in the Frost Desolation Abyss for long.

Next to the white bone sacrificial altar.

"Master," Curtis bowed and said.

"Why did you suddenly summon all of us?" Hua Anyang of Sky Mender Palace muttered in discontent. "We were just preparing to attack a Lord of the Abyss!"

"What happened?" Ji Yao asked curiously.

Qin Lie's Soul Beast avatar noticed Pei Tianchong's search and stopped under Seven Spirits Islands. He thought of some things and immediately municated with Curtis.

His connection to the soul slaves could cross space, so he did not have to worry about the barrier between Boluo Realm and the Frost Desolation Abyss.

When Curtis received his orders, he immediately contacted the experts of Sky Mender Palace, the Ji and Qin Families and Boluo Realm, saying that Qin Lie wanted to see them immediately.

These factions, and the experts who were not out fighting against the Abyss Devils, gathered next to the white bone sacrificial altar to wait after Curtis stated Qin Lie's intentions.

When Qin Lie's Soul Beast avatar came in Qin Lie's appearance, he was greeted by the sight of many people.

Ji Yao of the Ji Family, Hua Anyang of Sky Mender Palace, and Gan Feipeng of the Qin Family. Teng Yuan of Boluo Realm, Miao Yizi and the other experts were all waiting.

"I killed Pei Tianming," Qin Lie said.

"Pei Old Two is dead? You killed him?" The fat Gan Feipeng was shocked and then exclaimed, "He has a five-level Soul Altar, how could he have died by your hands? What happened?"

"Ninth Heaven will go mad." Ji Yao frowned.

He knew that Qin Lie's main battle body was a Rank Nine Soul Beast and knew that it did have the power to kill Pei Tianming.

Therefore, he believed the truth of Qin Lie's words.

Pei Tianming was a member of Ninth Heaven’s strongest family, Pei Family. Pei Tianchong was the current leader of Ninth Heaven, and his father Pei Tianchong was a nine-level Soul Altar expert!

Pei Tianming's death would cause the Pei Family to mobilize Ninth Heaven in search of revenge, creating a storm.

"Do they know you were the culprit?" Teng Yuan frowned.

Qin Lie nodded. "Pei Tianchong used a secret art of Ninth Heaven, and squeezed the last bit of power from Pei Tianming's shattered Soul Altar to see the killer, me, and my position, Boluo Realm."

Teng Yuan sighed with a bitter expression and said, "The reason they didn’t attack Boluo Realm the second time was because they thought we were only staying in Boluo Realm. With the looming God Race invasion, they did not want to offend the Ancient Beast Race, the Demon Dragon Race, the Giant Race, and the other races."

Pausing, he said, "Now that they know you are in Boluo Realm, they naturally realized that the Silver rank faction experts from the Land of Chaos should all be there too."

Gan Feipeng added, "They will probably even think Boluo Realm is Qin Family’s base."

"They will attack again." Ji Yao nodded slowly.

"This is why I gathered everyone." Qin Lie's expression was relatively calm as he said, "I want to know what the six factions will use to enter Boluo Realm? Do they have powerful Genesis Realm martial practitioners skilled in spatial secret arts to instantly reach Boluo Realm?"

"No." Miao Yizi, dressed in white, said coldly with a clear gaze. "None of the six factions have people skilled in space among martial practitioners who have reached the Genesis Realm. If they want to reach Boluo Realm, the fastest way is to use the Kunhuan Domain under control of Reincarnation Sect and travel through there."

"They can only choose the same plan as we did back then. The only difference will be the people ing will be very powerful. They may even send… Genesis Realm experts."

Qin Lie's expression darkened. "Genesis Realm..."

As long as it was not Genesis Realm experts, he was confident in his and Boluo Realm’s strength and the ultimate victory.

But if an early Genesis Realm expert was among the iners, his Rank Nine Soul Beast avatar did not have even a thirty percent chance of victory. What if more than one came?

"I will return to Boluo Realm and inform the old patriarch." Gan Feipeng thought for a moment and said, "Once the other party mobilizes Genesis Realm experts, your forces will not be of much use."

"I will return to Sky Mender Palace." Hua Anyang’s smile was gone, replaced by a grave frown. "Maybe you killing Pei Tianming will start our final battle prematurely."

"Yes, I will immediately notify the Ji Family," Ji Yao said.

They all realized that Pei Tianming's death would cause Pei Dehong to lose his calm, and tear apart the last barrier standing between guerilla warfare and an all-out war.

This meant that the Qin Family, Ji Family, Sky Mender Palace and six factions would start a bloody battle before the God Race arrived.

"Did my actions disrupt your arrangements?" Qin Lie said.

Ji Yao thought and said honestly, "Your grandfather seems to want to help the bigger picture and did not prepare to fight the six factions before God Race’s invasion."

"And now?" Qin Lie said.

"Up to them. If they use Genesis Realm experts, this battle cannot be avoided," Ji Yao explained.

"What was the place you talked about, the one they will go through?" Qin Lie suddenly asked Miao Yizi.

"Kunhuan Domain," Miao Yizi answered.

"I want to go to Kunhuan Domain," Qin Lie said.

Miao Yizi stilled and then said, "I will lead the way."

"Oh, thank you."

Ji Yao, Teng Yuan and the others all knew that Qin Lie's actual body had the magical ability, “Star Door”. They believed that Qin Lie's Rank Nine Soul Beast avatar, facing Genesis Realm experts, could easily escape using Star Door.

Therefore, they did not worry for the safety of Qin Lie's Soul Beast avatar.

Also, Miao Yizi, with her six-level Soul Altar, was skilled in the spatial arts and could help Qin Lie's main body stabilize space when forming the star door.

When the two of them were together, even if they fought Genesis Realm in Kunhuan Domain, they could easily leave.

Hence, they did not urge Qin Lie to not act rashly.

You are reading Spirit Realm Chapter 1305: The War Ahead of Time? on novel69. Use the chapter navigation above or below to continue reading the latest translated chapters.
Share with your friends
Library saves books to your account. Reading History saves recent chapters in this browser.
Continuous reading

You may also like

The Purgatory Calamity cover
Same author

The Purgatory Calamity

Ni Cang Tian ·Eastern

TheyoungPangJianwasforcedtoascendtotheheavens. …… ps:ThisisNiCangtian’snewworkafter“GodOfSlaughter”and“SpiritRealm”. Source:Webnovel.com,updatedonN...

God of Slaughter cover
Same author

God of Slaughter

Ni Cang Tian ·Action

Growingupparentless,ShiYan,whowasleftwithalargeinheritancemoney,boreageneraldisinterestinlife. Theonlytimeshefeltalivewaswhenadrenalinecoursedthoro...

Warlock Apprentice cover
Similar genre

Warlock Apprentice

牧狐 ·Fantasy

Thestatusofawizardistranscendentinallcontinentsandintheuniversalplane. Mysterious,wise,cruelandbloodthirstyaresynonymouswithwizards.Butwhatdoesarea...

No reviews yet. Be the first reader to leave one.
Please create an account or sign in to post a comment.