Font Size
15px

Chapter 1128: Two Flame Worlds

"You are not his match."

Gan Xing ignored Yan Feng's anger and spoke the truth, indicating for Yan Feng to stop.

In this group of ten, Yan Feng was a the vice captain. Gan Xing, however, was the true captain.

In terms of bloodline power, birth and battle prowess, Gan Xing was much stronger than Yan Feng.

Yan Feng also knew this.

In truth, Yan Feng held a thread of respect towards the younger Gan Xing.

Possibly due to this, while Yan Feng was furious, he only shouted a few times to vent his displeasure but did not argue with Gan Xing.

"e down, let me try," Gan Xing said.

"Let you try?" Yan Feng shook.

Now he realized what Gan Xing meant—Gan Xing was going to fight Qin Lie!

"Captain!"

The other eight young God Race clansmen couldn't help but shout, their eyes filled with disbelief.

They had not expected Gan Xing was going to fight Qin Lie.

Gan Xing was the most famous expert among the family's rank seven bloodline warriors, and his bloodline was far purer than Yan Feng’s.

Due to this, the young Gan Xing was their captain, one they accepted from the bottom of their heart.

Just his latent ability, Flame World, could greatly enhance their strength during battle.

A rank seven bloodline with Flame World latent ability. Only Gan Xing had awakened this latent ability among them.

Also, they knew that Gan Xing's bloodline was far more intricate than just Flame World.

When they heard Gan Xing was going to fight Qin Lie, Yan Feng, who had been angry, suddenly calmed down.

He knew he wasn’t Gan Xing’s match.

Gan Xing came out and wanted to fight Qin Lie. This meant that Gan Xing treated Qin Lie like an equal.

This meant... Qin Lie was actually a bit stronger than him.

When Yan Feng thought of this, while he found it difficult to accept, his expression turned slightly for the better.

He glanced coldly at Qin Lie, and then silently retreated.

Yan Feng landed at the entrance to the volcano. He stopped next to Wu Sha, Liu Yang, and the others.

"He has something that makes fire souls feel fear, you were not the only one. My Rank Eight Vermillion Bird was also terrified," Wu Sha consoled gently. "Do not blame the fire soul. It is intelligent. It knows if it continues to fight, it may die. It is hard for us to make a fire soul. Before our bloodline reaches rank nine, the fire soul will always be our good helper. Do not blame that fire dragon due to such a minor matter."

"This person is a bit special. Let’s just watch," Liu Yang urged.

Yan Feng's expression was dark. He nodded and said, "I know."

At this time, Gan Xing was slowly flying into the air.

Gan Xing was handsome and looked only eighteen or so. He usually had a gentle smile, his eyes flashing with the fire of intelligence.

When he flew into the sky, he bowed slightly to Qin Lie. He asked with a smile, "Do you wish to rest for a moment?"

Qin Lie narrowed his eyes and looked interestedly at him. "Are you Cang Ye's cousin?"

Gan Xing nodded with a smile.

"Which one of you is stronger?" Qin Lie asked.

Gan Xing thought and seriously replied. "Cousin Cang Ye is stronger than me."

Qin Lie smiled. He nodded and said, "Last time when she left, she said she would find my birth, have there been any developments?"

He was very surprised at accidentally ing to the Extreme Flame Abyss and encountering members of the Blaze Family.

Now that he was there, he also wanted to find lift the veil of mystery around his birth.

"You did not give her your blood. We could not confirm your birth." Gan Xing had a sincere expression. He said, "if you don’t mind, just give me a drop of your lifeblood essence. I will try to learn who your mother is, how about it?"

"How do I know you will not kill me?" Qin Lie asked.

"You have the blood of our family flowing in you. Unless you do something that greatly embarrasses the family, we will not do anything to you," Gan Xing guaranteed.

"Nevermind." Qin Lie shook his head.

He knew his bloodline was unusual. It could very well be the Perfect Blood the God Race had pursued for many years. He couldn’t be sure how God Race would react if his blood was made public.

He was worried he would be turned into a puppet by the present God Race clansmen. They would dissect him and drain his bloodline to study him.

Also, he didn’t know how the Blaze Family would react to a mixed-blood like him.

He had all kinds of concerns.

"It is alright if you don't care. I am not cousin Cang Ye, I do not like to force others." Gan Xing was not angry. He smiled and said, "When we e to Spirit Realm, we will learn your birth through other means."

"Oh, you are ing to Spirit Realm?" Qin Lie pretended to ask casually.

"Are we not already in the Abyss stocking up on flesh filled with refined energy?" Gan Xing did not conceal it. He said their aim and then said helplessly, "Other families have the Flesh Filling Tombstones, and they are much faster than our family. Also, the Blaze Family's Flesh Filling Tombstone supposedly was lost in a secret realm of Spirit Realm twenty thousand years ago. This has caused a delay in our invasion of the Extreme Flame Abyss."

Hearing him mention the Flesh Filling Tombstone, Qin Lie's eyes flashed and his mind changed slightly.

Through the explanation from the eight god generals, he knew the value of the Flesh Filling Tombstone. The God Race only had five Flesh Filling Tombstones, this was enough to prove the uniqueness of the item.

Right now, because the Blaze Family did not have the Flesh Filling Tombstone, their progres in the Extreme Flame Abyss had been slowed.

If they knew that the Flesh Filling Tombstone that had been lost in Spirit Realm was in his hands, he did not know what the experts of the Blaze Family would do.

When he thought of this, he immediately decided to not use the Flesh Filling Tombstone in the Extreme Flame Abyss.

He also had to avoid contact with the true experts of the Blaze Family.

He worried those experts with rank nine bloodline would feel the presence of the Flesh Filling Tombstone he hid in his spatial ring. If this was true, he did not think he could continue to have and use the Flesh Filling Tombstone.

"Cousin Cang Ye said that if we had the same rank bloodline, I might not be a match for you.”

At this time, Gan Xing took a deep breath. His expression became grave. "I will test the truth of her words."

Qin Lie looked down at Yan Feng and said calmly, "You should be stronger than him."

"Of course," Gan Xing said with a smile.

"Alright." Qin Lie nodded. "I also want to see just how strong the very best of the Blaze Family are."

"I hope I will not disappoint you," Gan Xing said.

When he finished, he immediately unleashed the Flame World in his bloodline. He filled the area with blazing flames, and formed a mysterious domain that could greatly amplify the power of the Blaze Family bloodline.

Qin Lie was also within the Flame World that Gan Xing had formed. However, unlike earlier when he was hiding within the volcano, he didn’t feel fortable being in this domain.

The power field produced by this Flame World seemed to suppress his bloodline.

He could not boil his bloodline as fast as possible.

"My Flame World is under my control. In my flame world, I can strengthen the bloodline of my race and also weaken it," Gan Xing said.

"You are not the only one who has awakened Flame World," Qin Lie shouted.

Tongues of flame flashing with divine characters formed around him.

Those divine characters danced around him and created a domain identical to Gan Xing’s.

—Qin Lie's Flame World.

You are reading Spirit Realm Chapter 1128 Two Flame Worlds on novel69. Use the chapter navigation above or below to continue reading the latest translated chapters.
Share with your friends
Library saves books to your account. Reading History saves recent chapters in this browser.
Continuous reading

You may also like

The Purgatory Calamity cover
Same author

The Purgatory Calamity

Ni Cang Tian ·Eastern

TheyoungPangJianwasforcedtoascendtotheheavens. …… ps:ThisisNiCangtian’snewworkafter“GodOfSlaughter”and“SpiritRealm”. Source:Webnovel.com,updatedonN...

God of Slaughter cover
Same author

God of Slaughter

Ni Cang Tian ·Action

Growingupparentless,ShiYan,whowasleftwithalargeinheritancemoney,boreageneraldisinterestinlife. Theonlytimeshefeltalivewaswhenadrenalinecoursedthoro...

No reviews yet. Be the first reader to leave one.
Please create an account or sign in to post a comment.