Font Size
15px

Chapter 1064: Serine’s Discovery

Ji Yao and Qin Lie talked in private on the giant floating continent above Boluo Realm.

An hour later, they returned to the cave entrance.

“Let’s return,” Ji Yao said.

“Is that all?” Ji Rui looked deeply puzzled.

Ji Yao gave him a smile. “I’ve learned all we needed to know during this trip, so there’s no need to hang around in Boluo Realm any longer.”

“But there’s still the Yu Family, the Dark Soul Beast, and some other matters, right?” Ji Rui grew more and more confused.

“We’ll talk after we return to our homes.” Ji Yao smiled.

Ji Rui and Ji Xi were filled with doubts, but they ultimately left Boluo Realm with Ji Yao.

When they returned to Soul Summoning Island, Ji Yao nodded at Li Mu and allowed him to guide them back to Flaming Sun island.

When Ji Yao met Duan Qianjie once more at Flaming Sun Island, he actually returned the Heavengold Mirror to Duan Qianjie.

His actions surprised Duan Qianjie.

“Qin Lie saved our lives once back in the chaotic streams of space. The Heavengold Mirror… is the reward he asked in return.” Ji Yao explained before passing a yellowish book to Duan Qianjie. “This book mentions some of the mirror’s abilities.”

Duan Qianjie looked a little puzzled as he accepted the Heavengold Mirror and the book.

“It’s unfortunate that the Heavengold Mirror is heavily damaged and nearly impossible to repair. I wouldn’t have gifted it to you otherwise.”

The trio left Flaming Sun Island after leaving behind the Heavengold Mirror and the book.

On the other side.

“I am Naji’s father and the chief of the Cullen Family, Carey. This here is my daughter Serine…”

Meanwhile, back in the Ancient Beast Race’s domain, Carey and his people walked to the foot of the mountain and told Qin Lie their identities.

“I’ll find a place for you all in Boluo Realm later.” Qin Lie nodded.

He left the Asura Race temporarily and went to speak with La Pu, Song Tingyu and Hua Yuchi in private.

“Was there really a Dark Soul Beast in Boluo Realm?” La Pu asked curiously.

“Are you okay?” Song Tingyu asked in concern.

“Why didn’t you tell Uncle Ji to stay behind?” Hua Yuchi asked.

It was obvious that all three people were concerned about different things.

“There is a Dark Soul Beast in Boluo Realm, but it is no longer a threat to anyone. There is no need for worry.” Qin Lie smiled. “You all should return to Soul Summoning Island in a while. Oh right, La Pu, please activate the teleportation formation and send Hua Yuchi straight to Nether Continent. He should return to Sky Mender Palace as fast as possible.”

“Alright.” La Pu nodded.

“It’d best if you didn’t mention the Dark Soul Beast to Sky Mender Palace.” Qin Lie looked at Hua Yauchi.

“Why’s that?” Hua Yuchi sounded astonished.

“You could say it has something to do with me...” Qin Lie said.

After a moment of surprise, Hua Yuchi nodded. “Then I shall refrain from mentioning the Dark Soul Beast.”

“Thank you.”

“There’s no need for such courtesy between us.”

The group continued to whisper among each other.

At the distance, the Cullen Family continued to wait for Qin Lie.

“Naji, didn’t you say that he was only at the middle stage of the Fragmentation Realm and rank six bloodline not long ago?” Serine’s diamond-like pupils glowed with astonishment. “It has only been a few months even if we started counting from the time you returned from the chaotic streams of space. So how did he progress so quickly? He’s in the Nirvana Realm now… even his bloodline seems to have reached rank seven already.”

“His cultivation speed is unbelievable,” Carey also said.

“Were you mistaken when you saw him last time?” Serine questioned Naji.

“I’m one hundred percent sure that he was at the middle stage of the Fragmentation Realm when he returned from the chaotic streams of space a few months ago. Even if I was mistaken, Uncle Hester wouldn’t make such a mistake,” Naji said.

Hester said seriously, “He was still a middle stage Fragmentation Realm martial practitioner with a rank six bloodline when we saw him at Flaming Sun Island last time!”

The Cullen Family clansmen’s expressions changed slightly when they heard this.

Qin Lie had apparently skipped the late stage of Fragmentation Realm, ascended directly into the Nirvana Realm and evolved his bloodline by one rank in an incredibly short amount of time. This cultivation speed was somewhat unbelievable.

“Is the God Race’s bloodline really that strong?” Serine exclaimed softly.

Carey pondered for a moment while frowning. “From what our family knows about the God Race… no. Not even the God Race is that crazy.”

“Then what is the reason?” Serine asked.

“It’s probably something only he knows about.” Carey shook his head before warning them all. “Remember, we must act cautiously and carefully here. We’re not in Suluo Realm any longer! Every race in this realm can exterminate us. We mustn’t act recklessly, no matter what!”

“Let us wait and see what Qin Lie has in store for us,” Hester sighed.

In the past, they had invaded the Land of Chaos and fought against the nine great Silver rank forces for many years.

At the time, the most powerful martial practitioner in the Land of Chaos was just at the late stage of the Imperishable Realm.

The Cullen Family alone was powerful enough to make life hell for the nine great Silver rank forces.

In the end, the nine great Silver rank forces were able to stop the Cullen Family’s invasion after hundreds of years of war.

It was why they felt a bit of scorn towards the Land of Chaos at the beginning.

Their old sense of superiority had prompted them to rush to Soul Summoning Island and force Flaming Sun Island to open the secret realm entrance for them.

However, as their understanding of Flaming Sun Island and Boluo Realm grew deeper, and after witnessing the three Ji Family experts’ arrival, they finally realized that Flaming Sun Island was unlike any Land of Chaos force they had fought before.

They also realized that the Cullen Family might not have the strength to establish themselves in Boluo Realm without Qin Lie’s aid.

“If the Dark Soul Beast in Boluo Realm isn’t dead… will the big miss be okay?” Josh, the Cullen Family’s old servant suddenly asked.

Josh was the old man who had weled Qin Lie and Naji back at the Suluo Realm valley that was filled with distorted energies of space.

He knew a lot of the Cullen Family’s secrets.

The moment he said this, Carey, Naji, Serine, and even Hester’s expressions changed.

“It’s all my fault. If I have secured the rank ten Dark Soul Beast skull properly, I would’ve been able to solve big sis’ sickness.” Naji blamed himself for his error.

“It was an accident.” Hester sighed.

“The thing that was operating in Boluo Realm is probably just the Dark Soul Beast’s subsoul. There cannot be a real Dark Soul Beast in this place,” Carey forted them.

“Big miss, did you… sense anything unusual?” The old servant named Josh looked deeply at Serine. He said, “If there really is a Dark Soul Beast in Boluo Realm, you may be able to sense it somewhat. After all… you used to be the one who had kept the rank ten Dark Soul Beast’s skull in safety with your secret art. You’ve also cultivated our family’s secret art all this time.”

“We should confirm this if at all possible.” Hester suggested.

Carey thought for a moment before agreeing, “We should confirm if a Dark Soul Beast lives in Boluo Realm if we wish to stay here.”

The crowd gradually turned to look at Serine.

Serine’s beautiful face had paled slightly in response. She seemed to be recalling the most terrifying memory.

“Big miss, please be strong,” Josh said softly.

Serine bit her bottom lip and nodded. She sat down where she stood and said, “I’ll give it a try.”

The crowd’s expressions turned serious as they all stared at her. Everyone was feeling a bit of trepidation.

Serine closed her eyes as her magnificent body suddenly trembled violently.

A ferocious soul ripple broke out from her body as if it could penetrate space itself and travel hundreds and thousands of kilometers away from here.

Meanwhile, Qin Lie’s eyes lit up the instant she executed her secret art.

He abruptly stopped talking to La Pu and Hua Yuchi as he turned to glance at Serine at the distance.

“What’s going on?” La Pu asked hastily. He had also sensed the extraordinary soul energy emanating from Serine.

“It’s okay.” Qin Lie shook his head. “Let’s leave it at this. You all should head back to Soul Summoning Island first. I still need to arrange the Cullen Family.”

He ended the conversation and urged La Pu and the others to return as soon as possible.

La Pu nodded. “Miss Song, Qin Lie still has some business to deal with, and you are needed at Flaming Sun Island. Young Master Hua Yuchi also needs to return to Sky Mender Palace as soon as possible…”

“...Alright.”

Miss Song and Hua Yuchi quickly entered the cave entrance where the secret realm entrance was.

After his three panions had left, Qin Lie slowly walked towards the Cullen Family with gleaming eyes.

“Sister, you don’t look so good. Are you feeling unwell?” Naji asked anxiously.

Right now, Serine’s face was as white as a paper, and she was sweating all over her body. Her diamond-like pupils had turned dim over time.

She was losing more and more soul energy.

“You can give up if it’s too much,” Carey felt distressed looking at her.

“Please hold on for a little while longer!” Josh exclaimed softly.

Suddenly, Serine began vomiting and shaking before everyone’s eyes.

The soul ripple spreading from her body abruptly vanished as a result.

Everyone stared at her intently.

“It’s still alive, it’s still alive!” Serine screamed.

You are reading Spirit Realm Chapter 1064: Serines Discovery on novel69. Use the chapter navigation above or below to continue reading the latest translated chapters.
Share with your friends
Library saves books to your account. Reading History saves recent chapters in this browser.
Continuous reading

You may also like

The Purgatory Calamity cover
Same author

The Purgatory Calamity

Ni Cang Tian ·Eastern

TheyoungPangJianwasforcedtoascendtotheheavens. …… ps:ThisisNiCangtian’snewworkafter“GodOfSlaughter”and“SpiritRealm”. Source:Webnovel.com,updatedonN...

God of Slaughter cover
Same author

God of Slaughter

Ni Cang Tian ·Action

Growingupparentless,ShiYan,whowasleftwithalargeinheritancemoney,boreageneraldisinterestinlife. Theonlytimeshefeltalivewaswhenadrenalinecoursedthoro...

No reviews yet. Be the first reader to leave one.
Please create an account or sign in to post a comment.