Font Size
15px

GDK 737: Justice

***The Sainte Residence.

Wallace was keeping Doyalo company when Rugersey carried the bloody Portlem into the room. Doyalo was Portlem’s uncle – the most important character in their envoy.

Portlem’s chest was covered with his blood. A small chunk of the cracked divine armor on his back was gone. Pieces of shattered wine glass were still sticking out from his flesh, spilling fresh blood.

Doyalo wore a dark face. As soon as he saw Portlem being carried inside, he flew to Portlem to hold him. In a deep voice, he asked, “What happened? Who dared harm you in the City of Shadows?”

The expression on Wallace’s face didn’t look good either. Doyalo and Portlem were so of the most important guests in the House of Sainte. Portlem being injured so badly wouldn’t look good on them.

“It’s those from the Celestial Pearl Pharmacy,” Charlotte replied softly.

Wallace bunched his brows. He turned to Rugersey and asked, “What happened?”

Rugersey handed Portlem to Doyalo and put on a solemn expression before answering, “There was a minor incident at the Celestial Pearl Pharmacy. There seed to be grudges between Andrina and Portlem. They started fighting in the banquet hall just like that.”

“So it was Andrina who injured Portlem?” Wallace’s heart sank and he imdiately asked. He had learned a little about Andrina from Andre. He had been mindful of this powerful little girl who would hang around Han Shuo. Knowing how powerful the little girl was, it wasn’t surprising that Wallace would have thought it was Andrina who did it.

“No,” Rugersey shook his head with a frown. “It was Bryan who severely injured Young Master Portlem!”

“What?” Wallace’s eyes widened. He said gravely, “Are you sure about that? Bryan is only a lowgod. How could he injure Portlem so severely?”

“It is true!” Charlotte wore an astonished look as she explained, “Everyone had underestimated his strength. He is even more vicious than Andrina. He did not use all his strength in his first strike when Portlem’s defenses were up, which caused Portlem to lower his guard. Bryan then took advantage of the situation, catching Portlem by surprise by suddenly attacking with his full strength!”

“How is that possible?!” Wallace was astonished. He turned to Rugersey and asked, “Is that so?”

Rugersey nodded and said, “It is indeed so. I reckon Lord Andre will be back soon. He was there when it happened. Your Lordship may verify the details with him.”

That youngster actually possesses highgod strength! Wallace exclaid in his mind. His eyes started to dazzle brightly.

Andre indeed knew his elder brother well. When Wallace heard that Portlem was injured in the City of Shadows, his first thought was to punish the attacker to appease his important guests. However, after learning that Han Shuo was the perpetrator and that he had displayed highgod strength, Wallace started running a cost-benefit analysis in his mind.

One of the reasons Wallace could command the enormous power and influence he did was that he valued talents highly. Wallace had been mindful about the presence of Andrina, a highgod, in the Celestial Pearl for a long ti. When he learned that Han Shuo too possessed highgod strength, he knew he had to consider his potential wins and losses carefully.

Doyalo examined Portlem’s condition. After making sure that the injuries did not threaten Portlem’s life, he raised his head, looked straight at Wallace, and asked, “I believe you will uphold justice for us, won’t you?”

“Don’t worry. I will do you justice as soon as I understand the whole sequence of events!” Wallace nodded and promised Doyalo. He then turned to Rugersey and questioned, “I know a little about Bryan’s character. He isn’t one who would do sothing like this out of the blue. What actually happened?”

“This... Erm...” Rugersey’s gaze turned to Portlem and Doyalo. He seed rather hesitant.

Wallace’s expression turned dark. He shouted, “Rugersey, did you not hear my question?”

Rugersey hastily replied, “Yes, my Lord! Andrina claid that while returning to the City of Shadows, she ran into Young Master Portlem. She alleged that Young Master Portlem tried to abduct Bryan’s won.” He added, “This is all I have heard from Andrina. I do not know about the specifics!”

Wallace had an idea of what happened after listening to Rugersey’s explanation. He had heard rumors about Portlem’s lascivious tendencies. It wasn’t at all surprising to Wallace that Portlem was accused of such acts.

“Mister Doyalo, if it was your side that instigated it, then it’ll be quite troubleso to deal with!” Wallace let out a sigh and said, “The rules of the City of Shadows apply to everyone in the City of Shadows. If I favor your side just because you are our guests, then I, the City Lord, will surely be criticized by all the large family clans!”

Doyalo’s expression turned sowhat sour as he could tell from those words that Wallace was leaning towards the Celestial Pearl’s side. Although the influences of Doyalo’s family clan was imnse, they were inside the City of Shadows, outside their sphere of influence. If Wallace, the City Lord, decided not to help them, there wasn’t much that they could do.

“What exactly do you an by that?” asked Doyalo.

“I will investigate the matter thoroughly and handle the case justly – impartial and without prejudice!” Wallace said righteously.

Soon enough, Andre returned from the Celestial Pearl Pharmacy. The first thing he did was wink at Andre.

Wallace nodded at Andre, excused himself from the party, went to a corner with Andre and started discussing in a low voice. A mont later, Wallace returned with a faint smile on his face and said to Doyalo, “The most important thing now is to treat and stabilize Portlem’s injuries. I will do an in-depth investigation of the incident!”

“I only hope that you will uphold justice for us. I have co to this city in representing the Church to discuss so issues with you. If you can’t even ensure the safety of my envoy, then your House of Sainte is really quite disappointing!” Doyalo said in a deep voice before leaving with Portlem.

After Doyalo, Portlem and Charlotte had left, Wallace sneered and remarked, “Trying to pressure with the Church? Dream on! Hehe, your House of Batchelder is just a tad stronger than my House of Sainte. And you have no power here!”

“Brother, Bryan the youngster is not to be looked down upon!” Andre said smilingly.

“Youth breeds heroism. The stronger he is, the happier I am!” Wallace laughed heartily, “If he was just an ordinary pharmacist, I might actually be unwilling to offend the House of Batchelder. But as things stand now, hehe, sorry Portlem, consider yourself unlucky!”

“But, my Lord, Doyalo ca here representing the Church!” reminded Rugersey.

“He rely represents the Church, it’s not like his House of Batchelder is the Church. I have nothing to be afraid of with him!” Wallace said disdainfully, “Besides, he ca here to seek my assistance, not the other way round. My House of Sainte serves the Overgod of Darkness. This little issue isn’t nearly enough to jeopardize the position of my House!”

“Rugersey, you may leave,” Andre smiled.

Rugersey nodded and tactfully left the Sainte Residence.

As soon as the brothers were left to themselves, Wallace asked Andre in an excited and elated manner, “Are you really sure that the youngster has highgod strength?”

“I have seen it with my own eyes!” affird Andre, “On top of that, the energy he uses is unconventional and very queer, even queerer than that of Andrina’s. This chap is truly unbelievable!”

“Fantastic!” cheered Wallace. He continued smilingly, “I don’t think that the House of Lavers has interest in staying in the City of Shadows. Eventually, soone’s gotta fill the empty spot they left. If I were to let the other three major family clans share those privileges, they may grow too big, and perhaps even threaten the position of my House of Sainte soday in the future. Bryan has only arrived on Elysium recently and doesn’t have many foundations here. His relationship with Carlita is good. I think it will be a decent choice to hand it to him instead. I did not take him as a candidate in the past because of his seemingly poor strength. But now, it appears that he is more suitable than Avery in taking this position!”

“Brother, you an you want to hand him the Fifth Corps?” Andre cried out in surprise.

“That’s right. The Fifth Corps has been left vacant for a long while. It’s about ti soone takes the seat!” Wallace nodded and replied.

“But we have put out word that anyone who wants to take the seat must exchange it with Avery’s head. How do we get past that?” Andre said with his brows bunched.

“This is a non-issue – we can alter the terms. If Bryan perford a great contribution to the City of Shadows, we can use that as a reason to hand the Fifth Corps to him. But this is not final yet and we are not in a hurry. I’m just saying that he could be a great candidate for the job,” said Wallace.

“Understood!” Andre then lanted, “This youngster could be said as having reached overnight success if he takes over the Fifth Corps!”

Half a month had passed with the snap of a finger. During this period, Han Shuo was on high alert, fearing that Portlem’s uncle would co to him to seek retribution.

However, Doyalo did not take a step into the Celestial Pearl. Not only that, but under the coercion of the House of Sainte, Doyalo and Portlem seed to have accepted it as a loss, although they certainly still felt animosity towards Han Shuo.

The mortals from Profound Continent were incredibly diligent in their cultivation. Other than Phoebe and Emily who needed to handle the daily business operations of the Celestial Pearl, none of them had taken a step out from their rooms.

Phoebe had again proven herself to be an extraordinary business manager. Under her guidance, most of the work in the Celestial Pearl beca smoother and more efficient. Her insights and experience related to business operations and managent were far superior to that of Gu Li’s. From having zero knowledge about dicine refinent, she managed to fully understand all the operations required to run a pharmacy within a short ti. The suggestions she introduced to improve those operations were very practical and effective.

Emily had been working on recruiting certain rare talents. She managed to obtain new human resources to work at the branches of the Celestial Pearl Pharmacy. With the help of his two extrely capable won, Han Shuo had almost no work to do in his business. He would calculate the earnings every once in a while and left the rest of the business fully to their control.

During the ti, Wallace, the City Lord of the City of Shadows, had personally co to visit the Celestial Pearl Pharmacy. Although he claid that he was there to investigate the incident about Portlem, during the visit, he had made it clear to Han Shuo that he admired him. He even told Han Shuo to be at ease and not let the incident affect his mood.

Although Han Shuo had been doing business in the City of Shadows for a long ti, for all this while, if Wallace had any business for Han Shuo, he would have Andre discuss with Han Shuo on his behalf. Wallace had never been to the Celestial Pearl Pharmacy even on its opening day.

However, just a few days after the havoc in the banquet hall, the esteed Wallace ca to visit the Celestial Pearl in person. It was obvious that his attitude had changed.

Soon after Wallace, the patriarchs of the other three major family clans visited the pharmacy one after another. Not only did they heavily condemn Portlem for his depraved deeds, they even praised Han Shuo for his acts in the hall!

As Wallace had been pressuring Carlita to cultivate, during the period, she had not taken a step out from her private gymnasium. Therefore, she had no clue about the recent happenings in the City of Shadows.

Erebus, on the very day he returned from a trip, went to look for Han Shuo. He was extrely astonished to learn about the might Han Shuo displayed on that day. He would reassure Han Shuo that given his understanding of Wallace, nothing would happen to him.

After having made much observation during this ti, Han Shuo had long co to be aware that Wallace intended to defend him. Erebus’ words had further confird his conclusion. Erebus had also invited Han Shuo to a friendly match, which Han Shuo had to decline as he could not use Cauldron Spirit’s energy for too long. If he was to accept the friendly match, it wouldn’t take long before his exaggerated image as a powerful expert as believed by all large family clans was shattered.

Fortunately, Erebus did not insist on it. He did not press on further after seeing that Han Shuo wasn’t interested in a friendly match with him. Before he left, he indirectly indicated to Han Shuo that his Celestial Pearl would have an even more solid position in the City of Shadows with him possessing mighty strength.

Han Shuo had recognized this fact from the sudden change of attitude among the family clans.

Compared to in the past, the mbers of large family clans who ca to the Celestial Pearl to purchase dicines nowadays showed much more sincerity and respect. After learning that the Celestial Pearl had two highgods of unfathomable strengths and they were absolutely ruthless when it ca to killing people, they no longer dared consider the Celestial Pearl as rely a larger than average pharmacy business.

With everything going on the perfect trajectory, Han Shuo had much more free ti to spend on cultivating.

Inside the Celestial Pearl’s gymnasium, Han Shuo and Akley were fighting each other under a gravity-intensifying field. Akley, a man thirsty for battle, believed that he could build his strength at the fastest rate by constantly putting himself in fierce battles. During recent tis, he had often fought with Han Shuo in the gymnasium.

While fighting Akley, Han Shuo would utilize the energy of his avatar of destruction. He would congeal multiple Orbs of Destruction with his two hands and bombard Akley with the Orbs traveling in orbits conforming to the edicts of destruction.

The Orb of Destruction was made by condensing destruction divine energy. They could hold an astonishing amount of power. Akley was strained in handling the attacks. He was traveling at such a high speed in the gymnasium that his figure beca a blurry shadow. As soon as he escaped from being confined by the Orbs, he would imdiately launch his powerful counterattack.

Boom! Boom! Boom! Sounded the noise of fierce battles. It did not take long before Akley beca utterly exhausted and was defeated.

“Dude, you really are such a freak. You cultivate in so many different energies at once but for whatever reason, you actually managed to cultivate every one of them to such an advanced level!” praised Akley.

Han Shuo’s demonic body was much tougher than Akley’s divine body. On top of that, after absorbing the godhunters’ divine energies, his avatar of destruction was on the verge of advancing to a midgod. Also, Han Shuo had more divine energy than Akley. Therefore, it wasn’t all that surprising that Akley would lose in a battle against Han Shuo.

“Alright, now move aside, Akley. It’s my turn!” Andrina imdiately walked over with a giggle when she saw Akley defeated. She brandished her two little fists before Han Shuo as she asked, “What’s the rule for today?”

“The sa old rule – we will fight for precisely three minutes, not a second longer!” replied Han Shuo. He could only last around three minutes boosting his strength using Cauldron Spirit’s energy. If he exceeds this ti limit, his demonic infant, the very core for his cultivation of demonic arts, would be injured.

Han Shuo had been having friendly matches with Andrina during recent tis too. He discovered that flooding his body with Cauldron Spirit’s imnse energy, although painful, was a good way to temper his body. He had a vague feeling that he was on the verge of making a breakthrough in his practice of Invincible On Body.

At the present ti, Han Shuo was able to deploy Invincible On Body through conscious thought. The next progression of this demonic skill was to have Invincible On Body automatically deployed when the body was attacked. Han Shuo had been trying to achieve this for a long ti but haven’t been able to.

Every ti he battled with Andrina, his body would be stressed by Cauldron Spirit’s energy. Although this was incredibly painful, his body would be strengthened each ti. He knew this from the fact that he could endure Cauldron Spirit’s energy longer with each battle. Although it would extend by rely a few seconds every ti, it was clear to Han Shuo that this practice was very beneficial to his cultivation.

“I really can’t make sense of you. Not once have you been able to last longer than a few minutes!” Andrina pouted her tiny mouth. As soon as she finished those words, she started attacking Han Shuo without warning. Dazzling radiance would shoot out from her body and fly towards Han Shuo in the shape of a vortex.

After having battled against Andrina in the gymnasium many tis, Han Shuo had grown familiar to her attack thods. As soon as he saw the dazzling vortex approaching, he deployed the Demonic Blades in his two hands. Streams of dark, dense gasses flowed out from the gaps between his fingers. The dark gas was ford using the energy of demon generals. It looked as though dark ribbons had grown out from his hands.

The ribbons of dark, dense gasses interwove, forming a giant net before Han Shuo. The giant net would creak and vaporize when the dazzling radiance fell into it.

At this mont, Han Shuo and Andrina, separated by the glowing vortex and giant dark net, launched attacks at each other. Shimring lights would shoot out from their hands.

Pow! One of Andrina’s attacks landed on Han Shuo. His imposing being took a hit. Andrina, as she usually would, took this opportunity to push forward. Han Shuo had no choice but to be on the defense.

Andrina was much stronger than Portlem, a fact which Han Shuo learned from having fought against her many tis. As the energy she cultivated in was unique, Han Shuo couldn’t figure out the actual strength Andrina possessed even till now. However, Han Shuo estimated it to be around mid to late stage highgod realm.

Pow! Andrina gently pressed her tender, little hand on Han Shuo’s chest and delivered him a blow.

“Eh?!” Han Shuo was sent retreating three steps backward but he appeared to be delighted by it.

You are reading Great Demon King Chapter 737 - Justice on novel69. Use the chapter navigation above or below to continue reading the latest translated chapters.
Share with your friends
Library saves books to your account. Reading History saves recent chapters in this browser.
Continuous reading

You may also like

The Purgatory Calamity cover
Same author

The Purgatory Calamity

Ni Cang Tian ·Eastern

TheyoungPangJianwasforcedtoascendtotheheavens. …… ps:ThisisNiCangtian’snewworkafter“GodOfSlaughter”and“SpiritRealm”. Source:Webnovel.com,updatedonN...

God of Slaughter cover
Same author

God of Slaughter

Ni Cang Tian ·Action

Growingupparentless,ShiYan,whowasleftwithalargeinheritancemoney,boreageneraldisinterestinlife. Theonlytimeshefeltalivewaswhenadrenalinecoursedthoro...

No reviews yet. Be the first reader to leave one.
Please create an account or sign in to post a comment.