Font Size
15px

GDK 586: I’ve Beco a God!

Years before, when Han Shuo was assassinating a grand duke, he suddenly lost self-control with his mind occupied by lust. When Han Shuo ca to his senses, he resisted this powerful energy forcibly altering his temperant and paid a huge price for it.

After many years, with Han Shuo now having beco a god, he realized that the energy he previously felt ca from spider goddess Rose. However, as they were separated by many material planes, Rose’s energy was greatly diminished and therefore she did not manage to subvert Han Shuo.

This debt of blood had always been on Han Shuo’s mind and he long had the intention of killing spider goddess Rose. When he returned to Brettel City to learn from Strathol that Adele had actually established shrines within his territories and appropriated his power of faith from the citizens of Brettel City, naturally, Han Shuo was outraged.

By using the altar at the center of the temple and with Adele as the dium, Han Shuo had successfully conveyed his wrath to spider goddess Rose. After obliterating Adele’s soul, she had absolutely no possibility of another resurrection.

All signs of life on her completely vanished. After casually letting go of her, Adele’s powerless body collapsed onto the pool of blood. Han Shuo placed one finger on the center of the altar. Ruthless energy was suddenly released, shattering the altar into pieces.

After his avatars cultivating in the energy death and destruction beca gods, Han Shuo gained so understanding as to how gods collected the power of faith. The altar Han Shuo shattered had the function of converging the power of faith and was the key communication link between spider goddess Rose and her disciples. Now that this altar was destroyed, without a mighty follower of hers rebuilding one, Rose would not be able to communicate with the souls of her disciples.

Take, for example, Han Shuo’s lowgod of death avatar; although separated material planes away, he could still receive the power of faith from the Abyss realm. Han Shuo could even vaguely sense the thoughts of those disciples that received Han Shuo’s Baptismal Radiance back in the Void.

Faith was an unusual matter which was incorporeal and yet clearly detectable. Through faith, Han Shuo could form so kind of mysterious connection with his disciples. What’s more, if those disciples of Han Shuo’s constructed an altar at the Abyss realm, they could even acquire a direct connection with Han Shuo even if they were separated innurable material planes away. Han Shuo could also bestow upon his disciples so of his energy through it.

Back then at the slave trading house of Valen City, Han Shuo once saw the scene where the three-eyed evil god manifested himself through bones and flesh in a pond of blood when a necromancer had successfully acquired a connection with the god using the bloody altar. These worked on the sa principle.

Han Shuo killed Adele and destroyed the altar, removing the roots of all evil altogether. However, those believers who were blocked outside of his invisible boundary still looked hatefully at him. They seed to be ready to charge forward at any mont and dismber Han Shuo’s body into a million pieces.

“I’m the City Lord of Brettel City. This woman was the root cause of rebellion and I’ve given her the death penalty. I now declare that from this mont onwards, within Brettel City and its territories, the practice of worshipping spider goddess Rose is outlawed,” Han Shuo announced plainly as he gazed at the people of Brettel City with cold eyes.

However, even as Han Shuo finished those words, he discovered that the animosity in these people’s eyes was still showing as before. It appeared that they did not abandon their faith towards spider goddess Rose just because he was the City Lord of Brettel City.

Once a commoner handed over their faith, it would usually be very difficult for them to walk out from this kind of influence. Although Han Shuo had an outstanding reputation compared to Rose who they had worshipped as their goddess for several years, Han Shuo fell far behind in terms of influence.

Seeing the hostility in their eyes, Han Shuo realized how thorny the problem was. Unless spider goddess Rose sohow died or these people sohow realized just how impotent their religion was by themselves, Han Shuo had no way of imdiately making these people leave from this kind of influence.

These people were citizens of Brettel City. Although their minds were deeply poisoned by Adele’s brainwashing, they mustn’t be killed. It appeared that all Han Shuo could do was to give it ti and slowly purge the influence from their souls.

“From today onwards, all temples of the spider goddess within Brettel City will be destroyed. No one shall pray and worship in her temples anymore,” Han Shuo bluntly commanded.

Every ti a believer piously worshipped at a shrine or temple, their dependence towards the god they believed in would deepen, increasing the influence on their soul. Due to reasons such as how staunch one’s willpower was and the length of ti one had practiced the faith, different believers would be dependent on their faith to different degrees.

For example, the zealots of the Church of Light were so of the most extre and fanatical believers. For these people, the god they believed in was their everything. Unless the god they believed in was killed, there would be no way to convert them. Additionally, this sort of people would kill others practicing any other religion without a care for their own lives!

For their kind, it was only through killing that all sins could be ridden!

When it ca to Rose’s followers in Brettel City, as the indoctrination had been rather brief and not as intense, they have yet to sink to that level of fanaticism and zealotry. As long as they were slowly rehabilitated and guided step by step, they would walk out from the influence of spider goddess Rose sooner or later.

After the trip to Mount Silk, Han Shuo t with Jack, Dorcas, and the others one by one to gain a better understanding of their current situations.

“Five years! How could you leave for five years just like that, you heartless bastard!” Helen Tina said in her soft voice as she fixed her fiery eyes on Han Shuo.

Even after five years, Helen still looked seductive and beautiful. Her imnse longing for Han Shuo had tornted her for half a decade. Now that the two finally got to see each other alone, Helen finally couldn’t restrain her excitent and threw herself into Han Shuo’s broad chest.

Wrapping Helen in his arms, taking in the faint, delicate fragrance coming from this beauty in his embrace, and sensing her emotions run as deep as the sea, Han Shuo put on a tender smile and said, “I’ve returned, haven’t I?”

Helen’s lovable body had unwittingly rose boiling hot while a kind of passionate feeling was brewing inside the badly lit room. After the long period of separation, Helen could no longer contain herself. With her hands on Han Shuo’s back, she took the initiative to stand on the tips of her toes, trying to give Han Shuo a peck.

When their lips touched, as though a runaway reaction, the two lost control with themselves. With one arm, Han Shuo lifted Helen by the waist. As she puffed and blew, Han Shuo impolitely ripped apart her fiery red magical gown and scaled her towering, smooth, tender peaks with his big hand.

“Oh... Five years, I have waited for five years! Bryan, give , give it to , I don’t want to wait any longer,” Helen said as she cried tears of joy while firmly hugging Han Shuo with all her strength.

The romantic mories they had in Helon City, the various beautiful sceneries they had visited as they traveled hand in hand – flashbacks as though it was just yesterday ca back into Han Shuo’s mind one after another...

Feeling the passion of the beauty in his arms, Han Shuo’s hands beca more and more unbridled. He tore off Helen’s silken undergarnts, removed her weaker and weaker resistance, and finally, she succumbed...

For the next few days in succession, all temples of the spider goddess in Brettel City and the forr seven grand duchies were demolished. Those who were still stubborn and obstinate were beheaded without the slightest rcy. The followers of the spider goddess were banned from carrying on with their worshipping and praying. They were also not allowed to set up an altar in private.

At the sa ti, at Han Shuo’s instructions, the City Lord’s statue was to be erected on previous sites of the spider goddess’ temple. The glorious achievents of the City Lord would be publicized and broadcast throughout the city. Then, drawing from the reverence and admiration the people of Brettel City had towards him, through so simple ceremonies, he would reorganize their faith to make them willingly offer their everything.

Han Shuo used his lowgod of destruction avatar to receive the power of faith from the citizens of Brettel City and the forr seven grand duchies. Having the experience from the lowgod of death avatar and having received guidance from Bechymos about the edict of destruction when they were outside of the Void, Han Shuo’s avatar cultivating in the energy of destruction could now deploy its own Domain of Divinity and receive the power of faith.

The series of thunderous operations Han Shuo conducted in Brettel City during the past few days had caused a trendous transformation on the city. When Strathol the old monster beca aware of Han Shuo’s conduct and deeds, he finally ca looking for Han Shuo by himself. Strange lights glowed from his eyes as he asked in a deep voice, “You have beco a god?”

For the past several days, Han Shuo razed everything that Adele built in the past five years to the ground as though he was breaking dried twigs. Moreover, he started to publicize his own great acts within Brettel City and its territories. By revealing his powerful might through certain thods, so of those citizens who had long adored him willingly offered him their faith.

Although Strathol had yet to beco a god, he understood that only a true god could use the power of faith. It was after pondering about Han Shuo’s recent series of actions that Strathol ca to an extrely shocking conclusion – Han Shuo had beco a god!

Therefore, he had so impatiently sought for Han Shuo, eager to verify if his judgnt was correct.

Looking at the Strathol keen to seek confirmation, Han Shuo put on a smile and openly admitted, “That’s right, I’ve beco a god!”

Although he knew in his heart that this would be the answer, Strathol nonetheless was ineffably shocked to hear Han Shuo’s affirmation. Strathol stood silent for a long while before he looked at Han Shuo with a sowhat embarrassed face and asked, “Do you mind giving so advice?”

Han Shuo involuntarily laughed before he answered frankly, “No problem.” He added after a short pause, “However, you will still need to rely on yourself for the most important breakthrough!”

Han Shuo had long had a favorable impression towards Strathol. Currently, he was just one step away from the realm of basegod. Contrary to what one might expect, Han Shuo was most willing to assist him.

You are reading Great Demon King Chapter 586: I’ve Become a God! on novel69. Use the chapter navigation above or below to continue reading the latest translated chapters.
Share with your friends
Library saves books to your account. Reading History saves recent chapters in this browser.
Continuous reading

You may also like

The Purgatory Calamity cover
Same author

The Purgatory Calamity

Ni Cang Tian ·Eastern

TheyoungPangJianwasforcedtoascendtotheheavens. …… ps:ThisisNiCangtian’snewworkafter“GodOfSlaughter”and“SpiritRealm”. Source:Webnovel.com,updatedonN...

God of Slaughter cover
Same author

God of Slaughter

Ni Cang Tian ·Action

Growingupparentless,ShiYan,whowasleftwithalargeinheritancemoney,boreageneraldisinterestinlife. Theonlytimeshefeltalivewaswhenadrenalinecoursedthoro...

Elven Invasion cover
Similar genre

Elven Invasion

Respro ·Action

MagicvsScience HumanvsElves EarthvsForestia MortalvsGod ThisisataleinwhichGoddessLunainordertosaveherplanetandcivilizationstartsainvasiononEarth,Wi...

No reviews yet. Be the first reader to leave one.
Please create an account or sign in to post a comment.