Font Size
15px

GDK 451: Origin Crystals

After the twelve round spheres had appeared in the middle of the altar, intense elental energy of all sorts, suddenly filled up the area which was previously devoid of any energy.

Concurrently, the four humanoids who were on the altar, each bearing five horns on their head, quickly sped up pouring the huge amount of magical creatures’ hearts and crystal cores into that big mouth.

There were thousands just like them worshipping the event under the altar. Their green eyes shone with excitent. They were not unlike the religious fanatics Han Shuo had co across, carrying a bigoted, unreasonably zealous attitude. Their bodies shivered slightly, whilst their droning sound gradually grew more and more energetic.

Han Shuo, hiding within the thick branches and leaves of a big tree, had a clear observation of everything happening in the big lake ahead. His heart held an uncontrollable desire to possess that ball which emitted the pure elental aura of death, but still, Han Shuo was not one to behave rashly.

The odd-looking creatures bearing the five horns, all emitted aura which could rival in its formidability to that of the Ancient Lizard King, a demi-god existence. If these four creatures were to join forces and circle around Han Shuo, Han Shuo was not certain that he could escape alive.

With eyes full of greediness, Han Shuo’s gaze remained unwavering at the round sphere filled with the rich elent of death. His mind stated to quickly consider all the ways and consequences of obtaining the sphere.

Suddenly, his senses projected three beings who were roughly similar in might. The appearance of these three beings who were slowly approaching gave Han Shuo an idea, his eyes light up with delight.

Han Shuo who had been very carefully hiding his body since the beginning, gradually glided towards the direction of the three whiffs presences, while quietly releasing a wisp of his own, concealed to which any ordinary person would have no ans to discover.

Indeed, as he planned, the strand of presence Han Shuo had deliberately leaked out, imdiately caused the approaching experts to sense it. With Han Shuo at the center, the three gathered together within a very short period of ti. In the blink of an eye, one after the other, the three mighty beings, originating from the Profound Continent, suddenly assembled a short distance away from Han Shuo.

“Eh? It’s you! The old monster!” As soon as the old man with his eyebrows encroaching his neck reached the place, he let out a soft cry and stared sowhat astonished at the forr State Preceptor of Verdun Dynasty, Strathol.

“Reynold you little bastard! You’re not dead yet! Hehe, good, good.” the handso, bewitching Strathol, teased at the lightning sacred magus of Brut rchant Alliance as he smiled delightedly.

The composed upper-class woman, enveloped in a faint hazy mist, was the last one to arrive. She shot a glance at Strathol and greeted him in a gentle voice, “Strathol, long ti no see!”

“Elder sister Tiana!” Strathol the old monster said smilingly after he bowed towards the upper-class woman wrapped in a mist in the distance.

This upper-class woman called Tiana nodded her head at the old monster in acknowledgent, and soon after turned to look at the smiling Han Shuo and asked in a puzzled face, “This is..?”

“Hehe, I’m a nobody. Erm, I ca from the Lancelot Empire!” While Han Shuo was gracefully bowing at the three, his heart was filled with shock. He didn’t expect that the old man with the long eyebrows was the lighting sacred magus Reynold Dila of the Brut rchant Alliance.

As a high ranking mber of the Dark Mantle, Han Shuo was aware of just how renowned this old man was in the Brut rchant Alliance. Even the leaders from the core rchant guilds that ford the Brut rchant Alliance, had to be reverent and respectful towards this old man, and will absolutely not be unbridled in front of him.

And yet, amongst the three, such a character was the one with the weakest strength.

In contrast to Strathol the old monster, and the upper-class woman nad Tiana, Reynold the lighting sacred magus was considerably more inferior. No matter how formidable Reynold was at the sacred grade, he was rely a sacred grade expert.

But Han Shuo could feel the formidable aura of a demi-god level expert from the body of Tiana, the upper-class woman, and Strathol the old monster. Strathol the old monster had a well-known reputation, and Han Shuo had heard of him ti and ti again. That this dirty old man who was the State Preceptor of Verdun Dynasty about a hundred years ago, could breakthrough to the demi-god realm, is sufficient to illustrate just how terrifying his strength must be.

Strathol the old monster whose appearance was inconsistent with his actual age addressed the upper-class woman as ‘Elder Sister Tiana’. Although Han Shuo is one of the highest ranking mbers in the Dark Mantle, he had no idea who this upper-class woman was. But by inferring on how Strathol addressed her, Han Shuo reasoned that this woman must be sowhat older than Strathol.

“Lancelot Empire? Since when did the Lancelot Empire possess an expert of such youth?” Tiana was sowhat flabbergasted and she, in a puzzled face, looked towards the old monster Strathol and lighting sacred magus Reynold.

“Bryan? Are you the city lord of Brettle City, that Bryan?” At first, Strathol’s brows were creased, but soon after he realized sothing and beam of glistering light shoot out from his eyes, landing on Han Shuo’s body.

“That’s right!” Han Shuo admitted.

“No wonder. It seems that rumors still possess so truth in them. I always thought that the Lancelot Empire exaggerated in saying that you forced two sacred-grade experts to retreat. Now it seems that there had indeed been such an incident!” the old monster said as he nodded.

When lighting sacred magus Reynold heard Han Shuo admit his identity, he focused his attention on Han Shuo. After carefully sizing Han Shuo up, with a weird look on his face, he said, “So it’s you. Hmm, what a brazen young man. Interesting.”

“Alright, let’s cut to the chase. I believe everyone is aware of the situation. For the ti being, we don’t have to worry about the whole sequence of events, but I presu that all of you know the nature of the twelve balls. The four fellas with the five horns, each possessed demi-god like strength. None among the four of us have the chance to succeed by going in alone. Are you all interested in cooperating?” Tiana the upper-class woman interrupted.

“Of course! The sooner the better!” Strathol the old monster was the first to concur.

Lighting sacred magus Reynold of Brut rchant Alliance, not only nodded in imdiate response, but he added further, ”I’m aware of my capabilities. Of the twelve balls, I’m only asking for the Origin Crystal of Lightning. Moreover, I will be in charge of dealing with the aftermath!”

“Alright. After it’s done, the Origin Crystal of Lightning will be yours. As for the both of you, we will divide the spoils according to our contributions. Any objections?” Tiana said solemnly as she looked at the old monster and Han Shuo. Naturally, she expects Han Shuo to agree to the proposal.

“I don’t have any objections. I trust that elder sister Tiana will be impartial!” Strathol replied in a relaxed manner as he shrugged. Imdiately after that he turned to look at Han Shuo and asked, “What about you?”

Han Shuo saw fit to join forces with them. However, it seed that all of them knew about the nature of the spheres, and only Han Shuo had no idea about their functions, even though he could sense the boundless energy within. Therefore, when Strathol averted the question to him, Han Shuo replied awkwardly, “I have no objection either. It’s just that, erm, honorable elders, what exactly are those twelve round spheres?”

All three of them simultaneously turned expressionless, as they took a double take at Han Shuo. Strathol stared blankly for a while, and said smilingly, “You don’t know?”

Shaking his head, Han Shuo honestly admitted, “I really don’t know.”

“Those are Origin Crystals of elents. After rging it with a magus’ soul, it will morph the soul into a Soul of Elent, causes the magus’ affinity of the elent to improve by a hundredfold, and reach a state where they will be most compatible with their elental energy – a magus with Soul of Elent could deploy magical spells instantaneously. Also, it will speed up a magus’ comprehension towards the understanding of the energy of sa origin. Erm, in short, it comprises of a lengthy list of benefits!” Strathol the old monster explained for Han Shuo forthright.

“The most important thing to note is that, only a magus that has ford a Soul of Elent possesses the capabilities to beco a god in their line of magic. Soul of Elent and Body of Elent are the foundations for a magus to beco a god!” The upper-class woman Tiana added on top of old monster Strathol’s explanation in a grave expression.

After hearing what both of them had to say, brilliant rays shot out from lightning sacred magus Reynold’s eyes like bite-sized lightning bolts were being discharged within his eyes. It was obvious that he was extrely thrilled.

Han Shuo, who was just as shocked, let out a soft cry. He finally understood why they were so excited and restless. Shortly after, he turned his attention to the twelve round balls far in the distance. After a short pause, he asked, “There are four balls without the presence of pure and intense elents. What about those?”

“Your are indeed attentive in your observations. Not all magic in this world is necessarily reliant on elents. Space magic and summoning magic are examples of that. Ok, the interior of those two spheres are in a nebula state. Those are the principles and profound comprehension towards space magic and summoning, and they can fuse with a magus’ soul to form Soul of Principles, which is sowhat similar to the Soul of Elent. Soul of Principles could be used by a magus to further their understanding towards the mysteries of space or summoning, and it is only by having a certain level of comprehension towards the mysteries of those principles, that a magus could truly beco a god, instead of demigod!” the upper-class woman Tiana explained after she gazed at Han Shuo in an astonished manner, sowhat surprised at Han Shuo’s remarkable sensory.

“The last two balls. The one constantly radiating lights of fighting aura is suitable for swordsman and knights to use, and helps warriors like us, form a Soul of War. Again, it has different effects compared to the others, but in essence it is basically the sa – allowing us to save a hundred or even a few hundred years worth of ti, in making our souls to possess the foundations of becoming a god. As for the last sphere that carries the aura of destruction, er, only suitable for psychos. No sane person would ever touch that!” Strathol continued.

“Let’s move, there’s no more ti for chit-chat!” Tiana suddenly spoke. Right after she finished those words, an azure coloured staff appeared in her hand.

You are reading Great Demon King Chapter 451: Origin Crystals on novel69. Use the chapter navigation above or below to continue reading the latest translated chapters.
Share with your friends
Library saves books to your account. Reading History saves recent chapters in this browser.
Continuous reading

You may also like

God of Slaughter cover
Same author

God of Slaughter

Ni Cang Tian ·Action

Growingupparentless,ShiYan,whowasleftwithalargeinheritancemoney,boreageneraldisinterestinlife. Theonlytimeshefeltalivewaswhenadrenalinecoursedthoro...

Spirit Realm cover
Same author

Spirit Realm

Ni Cang Tian ·Fantasy

Thirtythousandyearsago,theHeavenFightingRacewhocalledthemselves“Gods”invadedtheSpiritRealm.Hundredsofracesroseupinresistance,butultimatelysuffereda...

Sword God Reborn cover
Similar genre

Sword God Reborn

InkQuillWrites ·Action

Reincarnationistiresome.Thistime,IwillsurelyattaintheUltimateoftheSwordandfindeternalrest.“SwordGodReborn”Throughcountlessreincarnations,Ilivedagai...

Elven Invasion cover
Trending now

Elven Invasion

Respro ·Action

MagicvsScience HumanvsElves EarthvsForestia MortalvsGod ThisisataleinwhichGoddessLunainordertosaveherplanetandcivilizationstartsainvasiononEarth,Wi...

No reviews yet. Be the first reader to leave one.
Please create an account or sign in to post a comment.